BLASTX nr result
ID: Chrysanthemum21_contig00018947
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00018947 (418 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022035157.1| protein DEHYDRATION-INDUCED 19 homolog 4-lik... 62 7e-09 gb|PLY74345.1| hypothetical protein LSAT_8X164580 [Lactuca sativa] 59 5e-08 ref|XP_023733156.1| protein DEHYDRATION-INDUCED 19 homolog 3-lik... 59 1e-07 gb|KVI12526.1| Drought induced 19/ RING finger protein 114 [Cyna... 57 5e-07 >ref|XP_022035157.1| protein DEHYDRATION-INDUCED 19 homolog 4-like [Helianthus annuus] Length = 219 Score = 62.0 bits (149), Expect = 7e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 99 GLCKRKFHDDESFSIISLLRKKLQEHSRSLQKE 1 GLCKRK HDD+SFSI+SLLRKKLQEHSR+ QKE Sbjct: 97 GLCKRKLHDDDSFSIVSLLRKKLQEHSRTRQKE 129 >gb|PLY74345.1| hypothetical protein LSAT_8X164580 [Lactuca sativa] Length = 145 Score = 58.5 bits (140), Expect = 5e-08 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -2 Query: 99 GLCKRKFHDDESFSIISLLRKKLQEHSR-SLQKE 1 GLCKRK +DDESFSI+SLLRKKLQEHSR SLQKE Sbjct: 26 GLCKRKVYDDESFSIMSLLRKKLQEHSRLSLQKE 59 >ref|XP_023733156.1| protein DEHYDRATION-INDUCED 19 homolog 3-like [Lactuca sativa] Length = 221 Score = 58.5 bits (140), Expect = 1e-07 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -2 Query: 99 GLCKRKFHDDESFSIISLLRKKLQEHSR-SLQKE 1 GLCKRK +DDESFSI+SLLRKKLQEHSR SLQKE Sbjct: 102 GLCKRKVYDDESFSIMSLLRKKLQEHSRLSLQKE 135 >gb|KVI12526.1| Drought induced 19/ RING finger protein 114 [Cynara cardunculus var. scolymus] Length = 191 Score = 56.6 bits (135), Expect = 5e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 87 RKFHDDESFSIISLLRKKLQEHSRSLQKE 1 RK HDDESFSIISLLR+KLQEHSRSLQKE Sbjct: 76 RKLHDDESFSIISLLRRKLQEHSRSLQKE 104