BLASTX nr result
ID: Chrysanthemum21_contig00018807
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00018807 (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022012119.1| eukaryotic translation initiation factor 3 s... 65 2e-09 >ref|XP_022012119.1| eukaryotic translation initiation factor 3 subunit A-like [Helianthus annuus] gb|OTF95290.1| putative protein of unknown function DUF3223 [Helianthus annuus] Length = 685 Score = 64.7 bits (156), Expect = 2e-09 Identities = 37/111 (33%), Positives = 55/111 (49%) Frame = +1 Query: 70 GHDGAPSHEYGASNPYGWVGLYTNPCGKDSPARPDFGMGRDFCTPVWVGQQESNFRQKDR 249 G G P + A + GWVGLYT+ G + P + G DFC P WVG + F +K+ Sbjct: 296 GRQGPP---WEAGSSCGWVGLYTHRYGTYNQTGPGYSFGTDFCGPAWVGLHD--FSKKNG 350 Query: 250 PYEGTRTQNSRGTNGFEQEVVKIKETGWSRKKSEHNGENIVKTGQDEVFKD 402 P G+ +G ++ K+ ++GE VKTGQD++FK+ Sbjct: 351 PQLGSHKSKFKG-QPVNNDIEKV---------LSYSGEKFVKTGQDDIFKE 391