BLASTX nr result
ID: Chrysanthemum21_contig00018792
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00018792 (695 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POE60509.1| isoform 2 of nedd8-conjugating enzyme ubc12 [Quer... 59 6e-08 gb|OVA18653.1| Ubiquitin-conjugating enzyme [Macleaya cordata] 60 2e-07 gb|KVI06574.1| Ubiquitin-conjugating enzyme, active site-contain... 60 3e-07 gb|OTG16172.1| putative ubiquitin-conjugating enzyme/RWD-like pr... 60 4e-07 ref|XP_023763493.1| NEDD8-conjugating enzyme Ubc12-like [Lactuca... 59 6e-07 ref|XP_022015601.1| NEDD8-conjugating enzyme Ubc12-like [Heliant... 59 6e-07 ref|XP_021983666.1| NEDD8-conjugating enzyme Ubc12-like [Heliant... 59 6e-07 ref|XP_017243682.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-li... 59 6e-07 ref|XP_019174110.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-li... 58 8e-07 gb|KZM91675.1| hypothetical protein DCAR_020960 [Daucus carota s... 58 1e-06 ref|XP_022136196.1| NEDD8-conjugating enzyme Ubc12-like [Momordi... 58 1e-06 ref|XP_017258905.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-li... 58 1e-06 ref|XP_017254652.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [D... 58 1e-06 ref|XP_010095291.1| NEDD8-conjugating enzyme Ubc12 [Morus notabi... 58 1e-06 gb|PHU01250.1| NEDD8-conjugating enzyme Ubc12 [Capsicum chinense] 57 1e-06 gb|PHT32550.1| NEDD8-conjugating enzyme Ubc12 [Capsicum baccatum] 57 1e-06 ref|XP_019156235.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [I... 57 1e-06 ref|XP_016551453.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-li... 57 1e-06 gb|KZV28881.1| hypothetical protein F511_13676 [Dorcoceras hygro... 57 1e-06 ref|XP_022852450.1| NEDD8-conjugating enzyme Ubc12-like [Olea eu... 57 1e-06 >gb|POE60509.1| isoform 2 of nedd8-conjugating enzyme ubc12 [Quercus suber] Length = 91 Score = 58.9 bits (141), Expect = 6e-08 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -1 Query: 452 ARGKMIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 A GKMI+LFKVKEKQRE+AEN+NG P KK GEL L+K Sbjct: 33 AVGKMIKLFKVKEKQRELAENANGKTPVKKQSAGELRLHK 72 >gb|OVA18653.1| Ubiquitin-conjugating enzyme [Macleaya cordata] Length = 206 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/44 (70%), Positives = 33/44 (75%) Frame = -1 Query: 464 SRL*ARGKMIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 S L AR MIRLFKVKEKQREIAEN+NG P KK GEL L+K Sbjct: 16 SNLEARAIMIRLFKVKEKQREIAENANGRAPVKKQSAGELRLHK 59 >gb|KVI06574.1| Ubiquitin-conjugating enzyme, active site-containing protein [Cynara cardunculus var. scolymus] Length = 198 Score = 59.7 bits (143), Expect = 3e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -1 Query: 446 GKMIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 G MI+LFKVKEKQRE+AENSNG PP KK GEL L+K Sbjct: 14 GIMIKLFKVKEKQRELAENSNGKPPVKKQSAGELRLHK 51 >gb|OTG16172.1| putative ubiquitin-conjugating enzyme/RWD-like protein [Helianthus annuus] Length = 239 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -1 Query: 446 GKMIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 G MI+LFKVKEKQRE+AENSNG PP KK GEL L+K Sbjct: 55 GIMIKLFKVKEKQRELAENSNGKPPVKKQSAGELRLHK 92 >ref|XP_023763493.1| NEDD8-conjugating enzyme Ubc12-like [Lactuca sativa] gb|PLY85718.1| hypothetical protein LSAT_4X122061 [Lactuca sativa] Length = 183 Score = 58.5 bits (140), Expect = 6e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 440 MIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 MI+LFKVKEKQRE+AENSNG PP KK GEL L+K Sbjct: 1 MIKLFKVKEKQRELAENSNGKPPVKKQSAGELRLHK 36 >ref|XP_022015601.1| NEDD8-conjugating enzyme Ubc12-like [Helianthus annuus] ref|XP_022015602.1| NEDD8-conjugating enzyme Ubc12-like [Helianthus annuus] Length = 183 Score = 58.5 bits (140), Expect = 6e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 440 MIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 MI+LFKVKEKQRE+AENSNG PP KK GEL L+K Sbjct: 1 MIKLFKVKEKQRELAENSNGKPPVKKQSAGELRLHK 36 >ref|XP_021983666.1| NEDD8-conjugating enzyme Ubc12-like [Helianthus annuus] Length = 183 Score = 58.5 bits (140), Expect = 6e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 440 MIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 MI+LFKVKEKQRE+AENSNG PP KK GEL L+K Sbjct: 1 MIKLFKVKEKQRELAENSNGKPPVKKQSAGELRLHK 36 >ref|XP_017243682.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-like [Daucus carota subsp. sativus] gb|KZM99888.1| hypothetical protein DCAR_012750 [Daucus carota subsp. sativus] Length = 183 Score = 58.5 bits (140), Expect = 6e-07 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -1 Query: 440 MIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 MIRLFKVKEKQRE AENSNG PP KK GEL L+K Sbjct: 1 MIRLFKVKEKQREAAENSNGKPPVKKQSAGELRLHK 36 >ref|XP_019174110.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-like [Ipomoea nil] Length = 183 Score = 58.2 bits (139), Expect = 8e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 440 MIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 MI+LFKVKEKQREIAEN+NG PP KK GEL L+K Sbjct: 1 MIKLFKVKEKQREIAENANGKPPVKKQSAGELRLHK 36 >gb|KZM91675.1| hypothetical protein DCAR_020960 [Daucus carota subsp. sativus] Length = 177 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 440 MIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 MIRLFKVKEKQRE+AENS+G PP KK GEL L+K Sbjct: 1 MIRLFKVKEKQRELAENSDGKPPVKKQSAGELRLHK 36 >ref|XP_022136196.1| NEDD8-conjugating enzyme Ubc12-like [Momordica charantia] Length = 183 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 440 MIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 MI+LFKVKEKQREIAEN+NG PP KK GEL L K Sbjct: 1 MIKLFKVKEKQREIAENANGKPPVKKQSAGELRLQK 36 >ref|XP_017258905.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-like isoform X1 [Daucus carota subsp. sativus] Length = 183 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 440 MIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 MIRLFKVKEKQRE+AENS+G PP KK GEL L+K Sbjct: 1 MIRLFKVKEKQRELAENSDGKPPVKKQSAGELRLHK 36 >ref|XP_017254652.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [Daucus carota subsp. sativus] Length = 183 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 440 MIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 MIRLFKVKEKQRE+AENS+G PP KK GEL L+K Sbjct: 1 MIRLFKVKEKQRELAENSDGKPPVKKQSAGELRLHK 36 >ref|XP_010095291.1| NEDD8-conjugating enzyme Ubc12 [Morus notabilis] ref|XP_024020620.1| NEDD8-conjugating enzyme Ubc12 [Morus notabilis] gb|EXB59137.1| NEDD8-conjugating enzyme Ubc12 [Morus notabilis] Length = 183 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 440 MIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 MIRLFKVKEKQRE+AEN+NG PP KK GEL L+K Sbjct: 1 MIRLFKVKEKQRELAENANGGPPVKKQSAGELRLHK 36 >gb|PHU01250.1| NEDD8-conjugating enzyme Ubc12 [Capsicum chinense] Length = 183 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 440 MIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 MI+LFKVKEKQRE+AEN+NG PP KK GEL L+K Sbjct: 1 MIKLFKVKEKQRELAENANGKPPVKKQSAGELRLHK 36 >gb|PHT32550.1| NEDD8-conjugating enzyme Ubc12 [Capsicum baccatum] Length = 183 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 440 MIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 MI+LFKVKEKQRE+AEN+NG PP KK GEL L+K Sbjct: 1 MIKLFKVKEKQRELAENANGKPPVKKQSAGELRLHK 36 >ref|XP_019156235.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [Ipomoea nil] ref|XP_019156236.1| PREDICTED: NEDD8-conjugating enzyme Ubc12 [Ipomoea nil] Length = 183 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 440 MIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 MI+LFKVKEKQRE+AEN+NG PP KK GEL L+K Sbjct: 1 MIKLFKVKEKQRELAENANGKPPVKKQSAGELRLHK 36 >ref|XP_016551453.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-like [Capsicum annuum] ref|XP_016551454.1| PREDICTED: NEDD8-conjugating enzyme Ubc12-like [Capsicum annuum] gb|PHT66512.1| NEDD8-conjugating enzyme Ubc12 [Capsicum annuum] Length = 183 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 440 MIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 MI+LFKVKEKQRE+AEN+NG PP KK GEL L+K Sbjct: 1 MIKLFKVKEKQRELAENANGKPPVKKQSAGELRLHK 36 >gb|KZV28881.1| hypothetical protein F511_13676 [Dorcoceras hygrometricum] Length = 183 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 440 MIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 MI+LFKVKEKQRE+AEN+NG PP KK GEL L+K Sbjct: 1 MIKLFKVKEKQRELAENANGKPPVKKQSAGELRLHK 36 >ref|XP_022852450.1| NEDD8-conjugating enzyme Ubc12-like [Olea europaea var. sylvestris] ref|XP_022852451.1| NEDD8-conjugating enzyme Ubc12-like [Olea europaea var. sylvestris] gb|AAN75193.1| RUB1 conjugating enzyme [Olea europaea] Length = 183 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 440 MIRLFKVKEKQREIAENSNGMPPTKKHGLGELHLNK 333 MI+LFKVKEKQRE+AEN+NG PP KK GEL L+K Sbjct: 1 MIKLFKVKEKQRELAENANGKPPVKKQSAGELRLHK 36