BLASTX nr result
ID: Chrysanthemum21_contig00018579
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00018579 (387 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI08423.1| Thioredoxin [Cynara cardunculus var. scolymus] 67 1e-10 ref|XP_023768969.1| thioredoxin-like 1-1, chloroplastic [Lactuca... 60 4e-08 ref|XP_017239001.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 57 8e-07 ref|XP_023756818.1| thioredoxin-like 1-1, chloroplastic [Lactuca... 56 1e-06 ref|XP_009784833.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 56 2e-06 gb|KVH90699.1| Thioredoxin, partial [Cynara cardunculus var. sco... 56 2e-06 ref|XP_018632204.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 55 4e-06 ref|XP_022025945.1| thioredoxin-like 1-1, chloroplastic [Heliant... 55 4e-06 ref|XP_009621581.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 55 4e-06 ref|XP_004249307.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 54 5e-06 ref|XP_015088902.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 54 5e-06 ref|XP_019254776.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 54 5e-06 gb|PHT71332.1| Thioredoxin-like 1-1, chloroplastic [Capsicum ann... 54 7e-06 gb|PHT37033.1| hypothetical protein CQW23_24733 [Capsicum baccatum] 54 7e-06 ref|XP_016543659.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 54 7e-06 ref|XP_006351368.1| PREDICTED: thioredoxin-like 1-1, chloroplast... 54 9e-06 >gb|KVI08423.1| Thioredoxin [Cynara cardunculus var. scolymus] Length = 310 Score = 67.4 bits (163), Expect = 1e-10 Identities = 46/111 (41%), Positives = 54/111 (48%), Gaps = 10/111 (9%) Frame = +2 Query: 83 KMAEVIGKISISSSNYYRGNNYLCDKMKKLSPV----------RASLNVRSPAASXXXXX 232 KMAE+IGKIS + ++Y + +KKLSPV RASL VRS A Sbjct: 66 KMAEIIGKISSNYRFSASNHDYSRENLKKLSPVMIKMPAFSSLRASLTVRSSAGGEIFDP 125 Query: 233 XXXXXXXXXXXXXXCIQAVAAANSKMSIGIKKPVRWWEKGLKPNMKEVTGA 385 N KMS GI K V+WWEKG+KPNMKEVT A Sbjct: 126 R--------------------VNVKMSNGIGKSVKWWEKGIKPNMKEVTDA 156 >ref|XP_023768969.1| thioredoxin-like 1-1, chloroplastic [Lactuca sativa] gb|PLY81524.1| hypothetical protein LSAT_2X58761 [Lactuca sativa] Length = 266 Score = 60.1 bits (144), Expect = 4e-08 Identities = 40/110 (36%), Positives = 50/110 (45%), Gaps = 10/110 (9%) Frame = +2 Query: 86 MAEVIGKISISSSNYYRGNNYLCDKMKKLSPV----------RASLNVRSPAASXXXXXX 235 M +VIGKIS S N+ CD+ KK+S V RAS +RS A + Sbjct: 1 MVDVIGKISRSFKFSACNNDNACDRFKKISSVMIQMPAFSNLRASSTIRSSAGTKTID-- 58 Query: 236 XXXXXXXXXXXXXCIQAVAAANSKMSIGIKKPVRWWEKGLKPNMKEVTGA 385 + + I I K ++WWEKGLKPNMKEVTGA Sbjct: 59 ---------------RRTVVGGQQRGISIGKALKWWEKGLKPNMKEVTGA 93 >ref|XP_017239001.1| PREDICTED: thioredoxin-like 1-1, chloroplastic [Daucus carota subsp. sativus] gb|KZN00917.1| hypothetical protein DCAR_009671 [Daucus carota subsp. sativus] Length = 294 Score = 56.6 bits (135), Expect = 8e-07 Identities = 37/105 (35%), Positives = 49/105 (46%), Gaps = 6/105 (5%) Frame = +2 Query: 86 MAEVIGKISISSSNYYRGNNYL------CDKMKKLSPVRASLNVRSPAASXXXXXXXXXX 247 MA+++ K ++ SSN++ N+ + + K NVRS + S Sbjct: 1 MADILSKTNVFSSNFHHQNHKIRTWDSVSGENKSAHVSFKPFNVRSSSRSSFSNFSVRKV 60 Query: 248 XXXXXXXXXCIQAVAAANSKMSIGIKKPVRWWEKGLKPNMKEVTG 382 A A NSKMSIG+KK WWEKGLK NMKEV G Sbjct: 61 VAGRPNALKA--AAGACNSKMSIGLKKAPGWWEKGLKTNMKEVEG 103 >ref|XP_023756818.1| thioredoxin-like 1-1, chloroplastic [Lactuca sativa] gb|PLY90617.1| hypothetical protein LSAT_6X37901 [Lactuca sativa] Length = 295 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 281 QAVAAANSKMSIGIKKPVRWWEKGLKPNMKEVTGA 385 QA AA++ KMS+ I K +RWWEKGL+PNMKE+TGA Sbjct: 72 QAAAASDVKMSLSIGKSLRWWEKGLQPNMKEITGA 106 >ref|XP_009784833.1| PREDICTED: thioredoxin-like 1-1, chloroplastic [Nicotiana sylvestris] ref|XP_016482550.1| PREDICTED: thioredoxin-like 1-1, chloroplastic [Nicotiana tabacum] Length = 284 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = +2 Query: 290 AAANSKMSIGIKKPVRWWEKGLKPNMKEVTGA 385 AAA ++MSIGI+K +WWEKGL+PNMKEVTGA Sbjct: 65 AAATAQMSIGIRKAPKWWEKGLQPNMKEVTGA 96 >gb|KVH90699.1| Thioredoxin, partial [Cynara cardunculus var. scolymus] Length = 355 Score = 55.8 bits (133), Expect = 2e-06 Identities = 37/99 (37%), Positives = 50/99 (50%), Gaps = 11/99 (11%) Frame = +2 Query: 122 SNYYR----GNNYLCDKMKKLSPVR-----ASLNVR--SPAASXXXXXXXXXXXXXXXXX 268 SN+Y+ + + +K LSPV AS N+R S +S Sbjct: 41 SNHYKFSACNHGFARNKSDNLSPVMIKMPAASSNLRKSSTVSSAAGDFFGRRVDLGGKRR 100 Query: 269 XXCIQAVAAANSKMSIGIKKPVRWWEKGLKPNMKEVTGA 385 Q AA+N+ MSI I K ++WWEKGL+PNMKE+TGA Sbjct: 101 RVRTQVAAASNAMMSISIGKSLKWWEKGLQPNMKEITGA 139 >ref|XP_018632204.1| PREDICTED: thioredoxin-like 1-1, chloroplastic isoform X2 [Nicotiana tomentosiformis] Length = 278 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +2 Query: 290 AAANSKMSIGIKKPVRWWEKGLKPNMKEVTGA 385 AA +++MSIGI+K +WWEKGL+PNMKEVTGA Sbjct: 61 AAVSAQMSIGIRKAPKWWEKGLQPNMKEVTGA 92 >ref|XP_022025945.1| thioredoxin-like 1-1, chloroplastic [Helianthus annuus] gb|OTG35227.1| putative thioredoxin-like 1-1 protein [Helianthus annuus] Length = 290 Score = 54.7 bits (130), Expect = 4e-06 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 9/100 (9%) Frame = +2 Query: 113 ISSSNYYRGNN--YLCDKMKKLSPVRASLNVRSPA-------ASXXXXXXXXXXXXXXXX 265 +SS + G N + C ++ L PV + + S +S Sbjct: 5 MSSDCVFSGGNCGFGCSNLENLGPVMVKMPIWSKLGSSLTARSSGDGEFFGRSLTLKSQE 64 Query: 266 XXXCIQAVAAANSKMSIGIKKPVRWWEKGLKPNMKEVTGA 385 C A+++KMSI I K +RWWEKG++PNMKE+TGA Sbjct: 65 RRVCTHGANASDAKMSISIGKSLRWWEKGVQPNMKEITGA 104 >ref|XP_009621581.1| PREDICTED: thioredoxin-like 1-1, chloroplastic isoform X1 [Nicotiana tomentosiformis] ref|XP_016447006.1| PREDICTED: thioredoxin-like 1-1, chloroplastic [Nicotiana tabacum] Length = 292 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +2 Query: 290 AAANSKMSIGIKKPVRWWEKGLKPNMKEVTGA 385 AA +++MSIGI+K +WWEKGL+PNMKEVTGA Sbjct: 75 AAVSAQMSIGIRKAPKWWEKGLQPNMKEVTGA 106 >ref|XP_004249307.1| PREDICTED: thioredoxin-like 1-1, chloroplastic isoform X1 [Solanum lycopersicum] Length = 257 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 290 AAANSKMSIGIKKPVRWWEKGLKPNMKEVTGA 385 A A ++MSIGIK+ +WWEKGL+PNMKEVTGA Sbjct: 43 AVATAQMSIGIKRAPKWWEKGLQPNMKEVTGA 74 >ref|XP_015088902.1| PREDICTED: thioredoxin-like 1-1, chloroplastic isoform X1 [Solanum pennellii] Length = 261 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 290 AAANSKMSIGIKKPVRWWEKGLKPNMKEVTGA 385 A A ++MSIGIK+ +WWEKGL+PNMKEVTGA Sbjct: 43 AVATAQMSIGIKRAPKWWEKGLQPNMKEVTGA 74 >ref|XP_019254776.1| PREDICTED: thioredoxin-like 1-1, chloroplastic [Nicotiana attenuata] gb|OIS98089.1| thioredoxin-like 1-1, chloroplastic [Nicotiana attenuata] Length = 284 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 290 AAANSKMSIGIKKPVRWWEKGLKPNMKEVTGA 385 AA ++MSIGI+K +WWEKGL+PNMKEVTGA Sbjct: 65 AATTAQMSIGIRKAPKWWEKGLQPNMKEVTGA 96 >gb|PHT71332.1| Thioredoxin-like 1-1, chloroplastic [Capsicum annuum] Length = 285 Score = 53.9 bits (128), Expect = 7e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 290 AAANSKMSIGIKKPVRWWEKGLKPNMKEVTGA 385 A A+++MSIGIKK +WWEKGL+PNMKEV GA Sbjct: 68 AVASAQMSIGIKKAPKWWEKGLQPNMKEVNGA 99 >gb|PHT37033.1| hypothetical protein CQW23_24733 [Capsicum baccatum] Length = 285 Score = 53.9 bits (128), Expect = 7e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 290 AAANSKMSIGIKKPVRWWEKGLKPNMKEVTGA 385 A A+++MSIGIKK +WWEKGL+PNMKEV GA Sbjct: 68 AVASAQMSIGIKKAPKWWEKGLQPNMKEVNGA 99 >ref|XP_016543659.1| PREDICTED: thioredoxin-like 1-1, chloroplastic [Capsicum annuum] Length = 285 Score = 53.9 bits (128), Expect = 7e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 290 AAANSKMSIGIKKPVRWWEKGLKPNMKEVTGA 385 A A+++MSIGIKK +WWEKGL+PNMKEV GA Sbjct: 68 AVASAQMSIGIKKAPKWWEKGLQPNMKEVNGA 99 >ref|XP_006351368.1| PREDICTED: thioredoxin-like 1-1, chloroplastic isoform X1 [Solanum tuberosum] Length = 262 Score = 53.5 bits (127), Expect = 9e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 290 AAANSKMSIGIKKPVRWWEKGLKPNMKEVTGA 385 AAA ++MSIGI+K +WWEKGL+PNMKEV GA Sbjct: 43 AAATAQMSIGIRKAPKWWEKGLQPNMKEVMGA 74