BLASTX nr result
ID: Chrysanthemum21_contig00018551
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00018551 (366 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH99084.1| hypothetical protein Ccrd_022671, partial [Cynara... 52 7e-06 >gb|KVH99084.1| hypothetical protein Ccrd_022671, partial [Cynara cardunculus var. scolymus] Length = 135 Score = 52.0 bits (123), Expect = 7e-06 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 2/56 (3%) Frame = -1 Query: 162 LWTHFPEIGD-KAVSLNIMDTDGKEWRVSFSHWPYY-DNTYAMSDLRDFYVSKNLQ 1 + T FPE+ + K + LN++D +GKEW SF +WP TY + LR+ VS+ LQ Sbjct: 71 MMTFFPEVFEPKGIMLNVLDLEGKEWEFSFRYWPNCGSRTYVLEGLREIMVSRKLQ 126