BLASTX nr result
ID: Chrysanthemum21_contig00018543
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00018543 (352 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH93958.1| Bacterial transferase hexapeptide repeat-containi... 64 3e-10 ref|XP_021996543.1| probable acyl-[acyl-carrier-protein]--UDP-N-... 59 1e-07 ref|XP_021996542.1| probable acyl-[acyl-carrier-protein]--UDP-N-... 59 1e-07 gb|OTG03747.1| putative bacterial transferase hexapeptide repeat... 59 1e-07 ref|XP_021996541.1| probable acyl-[acyl-carrier-protein]--UDP-N-... 59 1e-07 ref|XP_022882646.1| probable acyl-[acyl-carrier-protein]--UDP-N-... 57 5e-07 ref|XP_018845985.1| PREDICTED: probable acyl-[acyl-carrier-prote... 56 8e-07 ref|XP_018845978.1| PREDICTED: probable acyl-[acyl-carrier-prote... 56 9e-07 ref|XP_018845969.1| PREDICTED: probable acyl-[acyl-carrier-prote... 56 9e-07 ref|XP_023744456.1| probable acyl-[acyl-carrier-protein]--UDP-N-... 55 2e-06 ref|XP_022882648.1| probable acyl-[acyl-carrier-protein]--UDP-N-... 55 2e-06 gb|PLY65783.1| hypothetical protein LSAT_5X145641 [Lactuca sativa] 55 2e-06 ref|XP_022882643.1| probable acyl-[acyl-carrier-protein]--UDP-N-... 55 2e-06 ref|XP_023744455.1| probable acyl-[acyl-carrier-protein]--UDP-N-... 55 2e-06 >gb|KVH93958.1| Bacterial transferase hexapeptide repeat-containing protein, partial [Cynara cardunculus var. scolymus] Length = 185 Score = 64.3 bits (155), Expect = 3e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 208 HEDLSRVSAVISLVQSILESL*EDRRGICKFRSWSFS 318 HEDLS V AV+SLVQSI ESL EDRRGICKFRSWSFS Sbjct: 149 HEDLSLVPAVLSLVQSIRESLGEDRRGICKFRSWSFS 185 >ref|XP_021996543.1| probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X3 [Helianthus annuus] Length = 265 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 208 HEDLSRVSAVISLVQSILESL*EDRRGICKFRSWSFS 318 H+DLS V AV+S VQSI ESL E RRGICKFRSWSFS Sbjct: 229 HKDLSLVPAVLSFVQSIRESLKEGRRGICKFRSWSFS 265 >ref|XP_021996542.1| probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X2 [Helianthus annuus] Length = 338 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 208 HEDLSRVSAVISLVQSILESL*EDRRGICKFRSWSFS 318 H+DLS V AV+S VQSI ESL E RRGICKFRSWSFS Sbjct: 302 HKDLSLVPAVLSFVQSIRESLKEGRRGICKFRSWSFS 338 >gb|OTG03747.1| putative bacterial transferase hexapeptide repeat-containing protein [Helianthus annuus] Length = 362 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 208 HEDLSRVSAVISLVQSILESL*EDRRGICKFRSWSFS 318 H+DLS V AV+S VQSI ESL E RRGICKFRSWSFS Sbjct: 326 HKDLSLVPAVLSFVQSIRESLKEGRRGICKFRSWSFS 362 >ref|XP_021996541.1| probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X1 [Helianthus annuus] Length = 366 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +1 Query: 208 HEDLSRVSAVISLVQSILESL*EDRRGICKFRSWSFS 318 H+DLS V AV+S VQSI ESL E RRGICKFRSWSFS Sbjct: 330 HKDLSLVPAVLSFVQSIRESLKEGRRGICKFRSWSFS 366 >ref|XP_022882646.1| probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X3 [Olea europaea var. sylvestris] Length = 311 Score = 57.0 bits (136), Expect = 5e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +1 Query: 196 MQGQHEDLSRVSAVISLVQSILESL*EDRRGICKFRSWSFS 318 M+ QH++LS V AV S+VQSI +S EDRRGICKFRSWS S Sbjct: 271 MEEQHKELSLVPAVSSMVQSIRDSFAEDRRGICKFRSWSAS 311 >ref|XP_018845985.1| PREDICTED: probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X3 [Juglans regia] Length = 291 Score = 56.2 bits (134), Expect = 8e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +1 Query: 205 QHEDLSRVSAVISLVQSILESL*EDRRGICKFRSWSFS 318 QHEDLSR+ AV S+V+SI +SL E RRGICKFR WS S Sbjct: 254 QHEDLSRIPAVCSMVRSIRDSLAESRRGICKFRHWSGS 291 >ref|XP_018845978.1| PREDICTED: probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X2 [Juglans regia] Length = 310 Score = 56.2 bits (134), Expect = 9e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +1 Query: 205 QHEDLSRVSAVISLVQSILESL*EDRRGICKFRSWSFS 318 QHEDLSR+ AV S+V+SI +SL E RRGICKFR WS S Sbjct: 273 QHEDLSRIPAVCSMVRSIRDSLAESRRGICKFRHWSGS 310 >ref|XP_018845969.1| PREDICTED: probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X1 [Juglans regia] Length = 338 Score = 56.2 bits (134), Expect = 9e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +1 Query: 205 QHEDLSRVSAVISLVQSILESL*EDRRGICKFRSWSFS 318 QHEDLSR+ AV S+V+SI +SL E RRGICKFR WS S Sbjct: 301 QHEDLSRIPAVCSMVRSIRDSLAESRRGICKFRHWSGS 338 >ref|XP_023744456.1| probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X2 [Lactuca sativa] ref|XP_023744457.1| probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X2 [Lactuca sativa] Length = 239 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 211 EDLSRVSAVISLVQSILESL*EDRRGICKFRSWSFS 318 E+LS + AV+SLV+SI +SL E+RRGICKFRSWSFS Sbjct: 204 EELSLIPAVVSLVKSIRDSLGENRRGICKFRSWSFS 239 >ref|XP_022882648.1| probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X5 [Olea europaea var. sylvestris] Length = 239 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +1 Query: 205 QHEDLSRVSAVISLVQSILESL*EDRRGICKFRSWSFS 318 QH++LS V AV S+VQSI +S EDRRGICKFRSWS S Sbjct: 202 QHKELSLVPAVSSMVQSIRDSFAEDRRGICKFRSWSAS 239 >gb|PLY65783.1| hypothetical protein LSAT_5X145641 [Lactuca sativa] Length = 313 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 211 EDLSRVSAVISLVQSILESL*EDRRGICKFRSWSFS 318 E+LS + AV+SLV+SI +SL E+RRGICKFRSWSFS Sbjct: 278 EELSLIPAVVSLVKSIRDSLGENRRGICKFRSWSFS 313 >ref|XP_022882643.1| probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X1 [Olea europaea var. sylvestris] ref|XP_022882644.1| probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X1 [Olea europaea var. sylvestris] Length = 340 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +1 Query: 205 QHEDLSRVSAVISLVQSILESL*EDRRGICKFRSWSFS 318 QH++LS V AV S+VQSI +S EDRRGICKFRSWS S Sbjct: 303 QHKELSLVPAVSSMVQSIRDSFAEDRRGICKFRSWSAS 340 >ref|XP_023744455.1| probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X1 [Lactuca sativa] Length = 341 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 211 EDLSRVSAVISLVQSILESL*EDRRGICKFRSWSFS 318 E+LS + AV+SLV+SI +SL E+RRGICKFRSWSFS Sbjct: 306 EELSLIPAVVSLVKSIRDSLGENRRGICKFRSWSFS 341