BLASTX nr result
ID: Chrysanthemum21_contig00018494
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00018494 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO69323.1| hypothetical protein CISIN_1g0360961mg, partial [... 66 9e-12 ref|XP_017248105.1| PREDICTED: lysine histidine transporter 1-li... 71 1e-11 gb|KJB33934.1| hypothetical protein B456_006G039200 [Gossypium r... 71 1e-11 ref|XP_024184987.1| lysine histidine transporter 1-like isoform ... 71 1e-11 ref|XP_016668369.1| PREDICTED: lysine histidine transporter 1-li... 71 1e-11 ref|XP_012483927.1| PREDICTED: lysine histidine transporter 1 [G... 71 1e-11 ref|XP_024184983.1| lysine histidine transporter 1-like isoform ... 71 1e-11 ref|XP_024184981.1| lysine histidine transporter 1-like isoform ... 71 1e-11 ref|XP_004304006.1| PREDICTED: lysine histidine transporter 1-li... 71 1e-11 gb|KJB33933.1| hypothetical protein B456_006G039200 [Gossypium r... 71 2e-11 gb|OMO81427.1| Amino acid transporter, transmembrane [Corchorus ... 70 2e-11 ref|XP_011042297.1| PREDICTED: lysine histidine transporter 1-li... 70 3e-11 ref|XP_011041568.1| PREDICTED: lysine histidine transporter 1-li... 70 3e-11 ref|XP_024184989.1| lysine histidine transporter 1-like isoform ... 69 5e-11 ref|XP_024184988.1| lysine histidine transporter 1-like isoform ... 69 5e-11 ref|XP_017975643.1| PREDICTED: lysine histidine transporter 1 [T... 69 5e-11 ref|XP_024184986.1| lysine histidine transporter 1-like isoform ... 69 5e-11 ref|XP_024184985.1| lysine histidine transporter 1-like isoform ... 69 5e-11 ref|XP_024184984.1| lysine histidine transporter 1-like isoform ... 69 5e-11 ref|XP_002315629.1| hypothetical protein POPTR_0010s06590g [Popu... 69 7e-11 >gb|KDO69323.1| hypothetical protein CISIN_1g0360961mg, partial [Citrus sinensis] Length = 59 Score = 65.9 bits (159), Expect = 9e-12 Identities = 30/45 (66%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = +1 Query: 25 REKAAAE--KALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 R++AA E KALNDWLP+T + +WWYS +HNVT MVGAGVLGL Sbjct: 7 RKEAAPENEKALNDWLPITKSRNAKWWYSAFHNVTAMVGAGVLGL 51 >ref|XP_017248105.1| PREDICTED: lysine histidine transporter 1-like [Daucus carota subsp. sativus] Length = 452 Score = 71.2 bits (173), Expect = 1e-11 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = +1 Query: 13 SNSCREKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 SN+ E AA EKA+NDWLP+TS + +WWYS +HNVT MVGAGVL L Sbjct: 17 SNNVDEMAAREKAINDWLPITSARNAKWWYSAFHNVTAMVGAGVLSL 63 >gb|KJB33934.1| hypothetical protein B456_006G039200 [Gossypium raimondii] Length = 426 Score = 70.9 bits (172), Expect = 1e-11 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = +1 Query: 13 SNSCREKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 SNS EK+A EKA+++WLP+TS + +WWYS +HNVT MVGAGVL L Sbjct: 14 SNSLEEKSAKEKAIDEWLPITSSRNAKWWYSAFHNVTAMVGAGVLSL 60 >ref|XP_024184987.1| lysine histidine transporter 1-like isoform X6 [Rosa chinensis] Length = 439 Score = 70.9 bits (172), Expect = 1e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +1 Query: 28 EKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 EK A EKA+NDWLP+TS + +WWYS +HNVT MVGAGVLGL Sbjct: 20 EKLAREKAINDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGL 61 >ref|XP_016668369.1| PREDICTED: lysine histidine transporter 1-like [Gossypium hirsutum] ref|XP_017611893.1| PREDICTED: lysine histidine transporter 1-like [Gossypium arboreum] gb|PPR90746.1| hypothetical protein GOBAR_AA29941 [Gossypium barbadense] Length = 449 Score = 70.9 bits (172), Expect = 1e-11 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = +1 Query: 13 SNSCREKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 SNS EK+A EKA+++WLP+TS + +WWYS +HNVT MVGAGVL L Sbjct: 14 SNSLEEKSAKEKAIDEWLPITSSRNAKWWYSAFHNVTAMVGAGVLSL 60 >ref|XP_012483927.1| PREDICTED: lysine histidine transporter 1 [Gossypium raimondii] ref|XP_016672688.1| PREDICTED: lysine histidine transporter 1-like [Gossypium hirsutum] gb|KJB33932.1| hypothetical protein B456_006G039200 [Gossypium raimondii] gb|PPD99508.1| hypothetical protein GOBAR_DD03461 [Gossypium barbadense] Length = 449 Score = 70.9 bits (172), Expect = 1e-11 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = +1 Query: 13 SNSCREKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 SNS EK+A EKA+++WLP+TS + +WWYS +HNVT MVGAGVL L Sbjct: 14 SNSLEEKSAKEKAIDEWLPITSSRNAKWWYSAFHNVTAMVGAGVLSL 60 >ref|XP_024184983.1| lysine histidine transporter 1-like isoform X2 [Rosa chinensis] Length = 450 Score = 70.9 bits (172), Expect = 1e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +1 Query: 28 EKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 EK A EKA+NDWLP+TS + +WWYS +HNVT MVGAGVLGL Sbjct: 20 EKLAREKAINDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGL 61 >ref|XP_024184981.1| lysine histidine transporter 1-like isoform X1 [Rosa chinensis] gb|PRQ54158.1| putative amino acid transporter, transmembrane domain-containing protein [Rosa chinensis] Length = 450 Score = 70.9 bits (172), Expect = 1e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +1 Query: 28 EKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 EK A EKA+NDWLP+TS + +WWYS +HNVT MVGAGVLGL Sbjct: 20 EKLAREKAINDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGL 61 >ref|XP_004304006.1| PREDICTED: lysine histidine transporter 1-like [Fragaria vesca subsp. vesca] Length = 450 Score = 70.9 bits (172), Expect = 1e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +1 Query: 28 EKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 EK A EKA+NDWLP+TS + +WWYS +HNVT MVGAGVLGL Sbjct: 20 EKLAKEKAINDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGL 61 >gb|KJB33933.1| hypothetical protein B456_006G039200 [Gossypium raimondii] Length = 480 Score = 70.9 bits (172), Expect = 2e-11 Identities = 30/47 (63%), Positives = 38/47 (80%) Frame = +1 Query: 13 SNSCREKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 SNS EK+A EKA+++WLP+TS + +WWYS +HNVT MVGAGVL L Sbjct: 14 SNSLEEKSAKEKAIDEWLPITSSRNAKWWYSAFHNVTAMVGAGVLSL 60 >gb|OMO81427.1| Amino acid transporter, transmembrane [Corchorus olitorius] Length = 444 Score = 70.5 bits (171), Expect = 2e-11 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = +1 Query: 13 SNSCREKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 S + REKA EKA+NDWLP+TS + +WWYS +HNVT MVGAGVL L Sbjct: 12 SETDREKADREKAINDWLPITSDRNAKWWYSAFHNVTAMVGAGVLSL 58 >ref|XP_011042297.1| PREDICTED: lysine histidine transporter 1-like [Populus euphratica] Length = 439 Score = 70.1 bits (170), Expect = 3e-11 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = +1 Query: 10 FSNSCREKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 ++ S ++AA EKA+NDWLPVTS + +WWYS +HNVT MVGAGVL L Sbjct: 3 YNESQNDEAAREKAINDWLPVTSSRNAKWWYSTFHNVTAMVGAGVLSL 50 >ref|XP_011041568.1| PREDICTED: lysine histidine transporter 1-like [Populus euphratica] Length = 439 Score = 70.1 bits (170), Expect = 3e-11 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = +1 Query: 10 FSNSCREKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 ++ S ++AA EKA+NDWLPVTS + +WWYS +HNVT MVGAGVL L Sbjct: 3 YNESQNDEAAREKAINDWLPVTSSRNAKWWYSTFHNVTAMVGAGVLSL 50 >ref|XP_024184989.1| lysine histidine transporter 1-like isoform X8 [Rosa chinensis] Length = 427 Score = 69.3 bits (168), Expect = 5e-11 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 28 EKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 EK A EKA+N+WLP+TS + +WWYS +HNVT MVGAGVLGL Sbjct: 20 EKLAKEKAINEWLPITSSRNAKWWYSAFHNVTAMVGAGVLGL 61 >ref|XP_024184988.1| lysine histidine transporter 1-like isoform X7 [Rosa chinensis] Length = 439 Score = 69.3 bits (168), Expect = 5e-11 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 28 EKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 EK A EKA+N+WLP+TS + +WWYS +HNVT MVGAGVLGL Sbjct: 20 EKLAKEKAINEWLPITSSRNAKWWYSAFHNVTAMVGAGVLGL 61 >ref|XP_017975643.1| PREDICTED: lysine histidine transporter 1 [Theobroma cacao] Length = 449 Score = 69.3 bits (168), Expect = 5e-11 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = +1 Query: 13 SNSCREKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 ++S EK A +KA++DWLP+TS + +WWYS +HNVT MVGAGVLGL Sbjct: 14 NDSFEEKLARQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLGL 60 >ref|XP_024184986.1| lysine histidine transporter 1-like isoform X5 [Rosa chinensis] Length = 450 Score = 69.3 bits (168), Expect = 5e-11 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 28 EKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 EK A EKA+N+WLP+TS + +WWYS +HNVT MVGAGVLGL Sbjct: 20 EKLAKEKAINEWLPITSSRNAKWWYSAFHNVTAMVGAGVLGL 61 >ref|XP_024184985.1| lysine histidine transporter 1-like isoform X4 [Rosa chinensis] Length = 450 Score = 69.3 bits (168), Expect = 5e-11 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 28 EKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 EK A EKA+N+WLP+TS + +WWYS +HNVT MVGAGVLGL Sbjct: 20 EKLAKEKAINEWLPITSSRNAKWWYSAFHNVTAMVGAGVLGL 61 >ref|XP_024184984.1| lysine histidine transporter 1-like isoform X3 [Rosa chinensis] gb|PRQ54162.1| putative amino acid transporter, transmembrane domain-containing protein [Rosa chinensis] Length = 450 Score = 69.3 bits (168), Expect = 5e-11 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 28 EKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 EK A EKA+N+WLP+TS + +WWYS +HNVT MVGAGVLGL Sbjct: 20 EKLAKEKAINEWLPITSSRNAKWWYSAFHNVTAMVGAGVLGL 61 >ref|XP_002315629.1| hypothetical protein POPTR_0010s06590g [Populus trichocarpa] gb|PNT14916.1| hypothetical protein POPTR_010G055800v3 [Populus trichocarpa] Length = 439 Score = 68.9 bits (167), Expect = 7e-11 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = +1 Query: 13 SNSCREKAAAEKALNDWLPVTSYCDVRWWYSFYHNVTTMVGAGVLGL 153 + S ++AA EKA+NDWLPVTS + +WWYS +HNVT MVGAGVL L Sbjct: 4 NESQNDEAAREKAINDWLPVTSSRNAKWWYSTFHNVTAMVGAGVLSL 50