BLASTX nr result
ID: Chrysanthemum21_contig00018479
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00018479 (383 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PRQ21265.1| putative glucose-6-phosphate isomerase [Rosa chin... 83 7e-18 gb|AIX93629.1| glucose-6-phosphate isomerase, partial [Paeonia c... 82 1e-17 ref|XP_021981949.1| glucose-6-phosphate isomerase 1, chloroplast... 85 2e-16 ref|XP_017242519.1| PREDICTED: glucose-6-phosphate isomerase 1, ... 85 2e-16 gb|KZV43358.1| glucose-6-phosphate isomerase 1, chloroplastic [D... 85 2e-16 ref|XP_011074228.1| glucose-6-phosphate isomerase 1, chloroplast... 85 2e-16 ref|XP_006841224.1| glucose-6-phosphate isomerase 1, chloroplast... 85 2e-16 ref|XP_018465411.1| PREDICTED: glucose-6-phosphate isomerase 1, ... 84 2e-16 ref|XP_018472144.1| PREDICTED: glucose-6-phosphate isomerase 1, ... 84 3e-16 ref|XP_013737975.1| LOW QUALITY PROTEIN: glucose-6-phosphate iso... 84 3e-16 ref|XP_009137464.1| PREDICTED: glucose-6-phosphate isomerase 1, ... 84 3e-16 emb|CDY11024.1| BnaA03g46830D [Brassica napus] 84 3e-16 ref|XP_006413409.1| glucose-6-phosphate isomerase 1, chloroplast... 84 3e-16 ref|XP_018472143.1| PREDICTED: glucose-6-phosphate isomerase 1, ... 84 3e-16 ref|XP_013692778.1| glucose-6-phosphate isomerase 1, chloroplast... 84 3e-16 ref|XP_013599007.1| PREDICTED: glucose-6-phosphate isomerase 1, ... 84 3e-16 ref|XP_013644209.1| glucose-6-phosphate isomerase 1, chloroplast... 84 3e-16 ref|XP_019576249.1| PREDICTED: LOW QUALITY PROTEIN: glucose-6-ph... 84 3e-16 ref|XP_013739335.1| glucose-6-phosphate isomerase 1, chloroplast... 84 3e-16 ref|XP_013618315.1| PREDICTED: LOW QUALITY PROTEIN: glucose-6-ph... 84 3e-16 >gb|PRQ21265.1| putative glucose-6-phosphate isomerase [Rosa chinensis] Length = 119 Score = 82.8 bits (203), Expect = 7e-18 Identities = 41/45 (91%), Positives = 41/45 (91%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPMFDWVGGRTS MSAVGLL AALQGIDI Sbjct: 37 NSLLDNTARIEGWLARFPMFDWVGGRTSEMSAVGLLPAALQGIDI 81 >gb|AIX93629.1| glucose-6-phosphate isomerase, partial [Paeonia californica] Length = 120 Score = 82.4 bits (202), Expect = 1e-17 Identities = 41/44 (93%), Positives = 41/44 (93%) Frame = +1 Query: 4 SLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 SLLD TARIEGWLA FPMFDWVGGRTS MSAVGLLAAALQGIDI Sbjct: 74 SLLDNTARIEGWLARFPMFDWVGGRTSEMSAVGLLAAALQGIDI 117 >ref|XP_021981949.1| glucose-6-phosphate isomerase 1, chloroplastic [Helianthus annuus] gb|OTG14568.1| putative phosphoglucose isomerase 1 [Helianthus annuus] Length = 611 Score = 84.7 bits (208), Expect = 2e-16 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPMFDWVGGRTS MSAVGLLAAALQGIDI Sbjct: 281 NSLLDNTARIEGWLARFPMFDWVGGRTSEMSAVGLLAAALQGIDI 325 >ref|XP_017242519.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Daucus carota subsp. sativus] gb|KZN00817.1| hypothetical protein DCAR_009571 [Daucus carota subsp. sativus] Length = 613 Score = 84.7 bits (208), Expect = 2e-16 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPMFDWVGGRTS MSAVGLLAAALQGIDI Sbjct: 283 NSLLDNTARIEGWLARFPMFDWVGGRTSEMSAVGLLAAALQGIDI 327 >gb|KZV43358.1| glucose-6-phosphate isomerase 1, chloroplastic [Dorcoceras hygrometricum] Length = 623 Score = 84.7 bits (208), Expect = 2e-16 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPMFDWVGGRTS MSAVGLLAAALQGIDI Sbjct: 294 NSLLDNTARIEGWLARFPMFDWVGGRTSEMSAVGLLAAALQGIDI 338 >ref|XP_011074228.1| glucose-6-phosphate isomerase 1, chloroplastic [Sesamum indicum] Length = 623 Score = 84.7 bits (208), Expect = 2e-16 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPMFDWVGGRTS MSAVGLLAAALQGIDI Sbjct: 293 NSLLDNTARIEGWLARFPMFDWVGGRTSEMSAVGLLAAALQGIDI 337 >ref|XP_006841224.1| glucose-6-phosphate isomerase 1, chloroplastic [Amborella trichopoda] gb|ERN02899.1| hypothetical protein AMTR_s00135p00052570 [Amborella trichopoda] Length = 624 Score = 84.7 bits (208), Expect = 2e-16 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPMFDWVGGRTS MSAVGLLAAALQGIDI Sbjct: 294 NSLLDNTARIEGWLARFPMFDWVGGRTSEMSAVGLLAAALQGIDI 338 >ref|XP_018465411.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic, partial [Raphanus sativus] Length = 444 Score = 84.0 bits (206), Expect = 2e-16 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPM+DWVGGRTSVMSAVGLL AALQGIDI Sbjct: 114 NSLLDNTARIEGWLARFPMYDWVGGRTSVMSAVGLLPAALQGIDI 158 >ref|XP_018472144.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic isoform X2 [Raphanus sativus] Length = 582 Score = 84.0 bits (206), Expect = 3e-16 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPM+DWVGGRTSVMSAVGLL AALQGIDI Sbjct: 284 NSLLDNTARIEGWLARFPMYDWVGGRTSVMSAVGLLPAALQGIDI 328 >ref|XP_013737975.1| LOW QUALITY PROTEIN: glucose-6-phosphate isomerase 1, chloroplastic-like [Brassica napus] Length = 609 Score = 84.0 bits (206), Expect = 3e-16 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPM+DWVGGRTSVMSAVGLL AALQGIDI Sbjct: 281 NSLLDNTARIEGWLARFPMYDWVGGRTSVMSAVGLLPAALQGIDI 325 >ref|XP_009137464.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Brassica rapa] Length = 613 Score = 84.0 bits (206), Expect = 3e-16 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPM+DWVGGRTSVMSAVGLL AALQGIDI Sbjct: 283 NSLLDNTARIEGWLARFPMYDWVGGRTSVMSAVGLLPAALQGIDI 327 >emb|CDY11024.1| BnaA03g46830D [Brassica napus] Length = 613 Score = 84.0 bits (206), Expect = 3e-16 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPM+DWVGGRTSVMSAVGLL AALQGIDI Sbjct: 283 NSLLDNTARIEGWLARFPMYDWVGGRTSVMSAVGLLPAALQGIDI 327 >ref|XP_006413409.1| glucose-6-phosphate isomerase 1, chloroplastic [Eutrema salsugineum] dbj|BAJ34119.1| unnamed protein product [Eutrema halophilum] gb|ESQ54862.1| hypothetical protein EUTSA_v10024695mg [Eutrema salsugineum] Length = 613 Score = 84.0 bits (206), Expect = 3e-16 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPM+DWVGGRTSVMSAVGLL AALQGIDI Sbjct: 283 NSLLDNTARIEGWLARFPMYDWVGGRTSVMSAVGLLPAALQGIDI 327 >ref|XP_018472143.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic isoform X1 [Raphanus sativus] Length = 614 Score = 84.0 bits (206), Expect = 3e-16 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPM+DWVGGRTSVMSAVGLL AALQGIDI Sbjct: 284 NSLLDNTARIEGWLARFPMYDWVGGRTSVMSAVGLLPAALQGIDI 328 >ref|XP_013692778.1| glucose-6-phosphate isomerase 1, chloroplastic-like [Brassica napus] Length = 614 Score = 84.0 bits (206), Expect = 3e-16 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPM+DWVGGRTSVMSAVGLL AALQGIDI Sbjct: 284 NSLLDNTARIEGWLARFPMYDWVGGRTSVMSAVGLLPAALQGIDI 328 >ref|XP_013599007.1| PREDICTED: glucose-6-phosphate isomerase 1, chloroplastic [Brassica oleracea var. oleracea] Length = 614 Score = 84.0 bits (206), Expect = 3e-16 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPM+DWVGGRTSVMSAVGLL AALQGIDI Sbjct: 284 NSLLDNTARIEGWLARFPMYDWVGGRTSVMSAVGLLPAALQGIDI 328 >ref|XP_013644209.1| glucose-6-phosphate isomerase 1, chloroplastic [Brassica napus] Length = 614 Score = 84.0 bits (206), Expect = 3e-16 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPM+DWVGGRTSVMSAVGLL AALQGIDI Sbjct: 284 NSLLDNTARIEGWLARFPMYDWVGGRTSVMSAVGLLPAALQGIDI 328 >ref|XP_019576249.1| PREDICTED: LOW QUALITY PROTEIN: glucose-6-phosphate isomerase 1, chloroplastic-like [Rhinolophus sinicus] Length = 616 Score = 84.0 bits (206), Expect = 3e-16 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPM+DWVGGRTSVMSAVGLL AALQGIDI Sbjct: 286 NSLLDNTARIEGWLARFPMYDWVGGRTSVMSAVGLLPAALQGIDI 330 >ref|XP_013739335.1| glucose-6-phosphate isomerase 1, chloroplastic-like [Brassica napus] Length = 616 Score = 84.0 bits (206), Expect = 3e-16 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPM+DWVGGRTSVMSAVGLL AALQGIDI Sbjct: 286 NSLLDNTARIEGWLARFPMYDWVGGRTSVMSAVGLLPAALQGIDI 330 >ref|XP_013618315.1| PREDICTED: LOW QUALITY PROTEIN: glucose-6-phosphate isomerase 1, chloroplastic [Brassica oleracea var. oleracea] Length = 616 Score = 84.0 bits (206), Expect = 3e-16 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +1 Query: 1 NSLLDITARIEGWLAGFPMFDWVGGRTSVMSAVGLLAAALQGIDI 135 NSLLD TARIEGWLA FPM+DWVGGRTSVMSAVGLL AALQGIDI Sbjct: 285 NSLLDNTARIEGWLARFPMYDWVGGRTSVMSAVGLLPAALQGIDI 329