BLASTX nr result
ID: Chrysanthemum21_contig00018456
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00018456 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKI75150.1| hypothetical protein CRG98_004485 [Punica granatum] 67 4e-12 ref|NP_001235523.1| uncharacterized protein LOC100499751 [Glycin... 66 1e-11 ref|XP_002307746.2| hypothetical protein POPTR_0005s26570g [Popu... 69 1e-11 gb|PNT38529.1| hypothetical protein POPTR_005G244300v3 [Populus ... 69 1e-11 gb|OTF96973.1| putative DNA/RNA-binding protein Alba-like protei... 69 2e-11 ref|XP_023757444.1| uncharacterized protein LOC111905945 [Lactuc... 69 2e-11 ref|XP_022008705.1| uncharacterized protein LOC110908109 [Helian... 69 3e-11 gb|OTG04832.1| putative DNA/RNA-binding protein Alba-like protei... 69 3e-11 ref|XP_021997599.1| heterogeneous nuclear ribonucleoprotein 87F-... 69 3e-11 ref|XP_021997596.1| translation initiation factor IF-2-like isof... 69 3e-11 gb|PNT47286.1| hypothetical protein POPTR_002G017600v3 [Populus ... 68 4e-11 ref|XP_021601813.1| ribonuclease P protein subunit p25-like prot... 68 4e-11 ref|XP_021661123.1| ribonuclease P protein subunit p25-like prot... 68 5e-11 ref|XP_021668125.1| ribonuclease P protein subunit p25-like prot... 68 5e-11 ref|XP_012073732.1| ribonuclease P protein subunit p25-like prot... 68 5e-11 ref|XP_021611911.1| ribonuclease P protein subunit p25-like prot... 68 5e-11 ref|XP_011003072.1| PREDICTED: ribonuclease P protein subunit p2... 68 5e-11 ref|XP_021285168.1| ribonuclease P protein subunit p25-like prot... 68 5e-11 ref|XP_021601812.1| ribonuclease P protein subunit p25-like prot... 68 5e-11 ref|XP_015887333.1| PREDICTED: ribonuclease P protein subunit p2... 68 5e-11 >gb|PKI75150.1| hypothetical protein CRG98_004485 [Punica granatum] Length = 98 Score = 67.4 bits (163), Expect = 4e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGS EIVFKAMGR INKTVTIVELIKRRIVGLHQI Sbjct: 41 QEKGSDEIVFKAMGRAINKTVTIVELIKRRIVGLHQI 77 >ref|NP_001235523.1| uncharacterized protein LOC100499751 [Glycine max] gb|ACU13476.1| unknown [Glycine max] gb|KRH05991.1| hypothetical protein GLYMA_17G260600 [Glycine max] Length = 98 Score = 66.2 bits (160), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQ 336 +EKGS+EIVFKAMGR INKTVTIVELIKRRIVGLHQ Sbjct: 41 QEKGSNEIVFKAMGRAINKTVTIVELIKRRIVGLHQ 76 >ref|XP_002307746.2| hypothetical protein POPTR_0005s26570g [Populus trichocarpa] gb|PNT38527.1| hypothetical protein POPTR_005G244300v3 [Populus trichocarpa] gb|PNT38528.1| hypothetical protein POPTR_005G244300v3 [Populus trichocarpa] Length = 250 Score = 69.3 bits (168), Expect = 1e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQIFLSSS 354 +EKGS+EIVFKAMGR INKTVTIVELIKRRIVGLHQI L S Sbjct: 41 QEKGSNEIVFKAMGRAINKTVTIVELIKRRIVGLHQITLIGS 82 >gb|PNT38529.1| hypothetical protein POPTR_005G244300v3 [Populus trichocarpa] Length = 254 Score = 69.3 bits (168), Expect = 1e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQIFLSSS 354 +EKGS+EIVFKAMGR INKTVTIVELIKRRIVGLHQI L S Sbjct: 41 QEKGSNEIVFKAMGRAINKTVTIVELIKRRIVGLHQITLIGS 82 >gb|OTF96973.1| putative DNA/RNA-binding protein Alba-like protein [Helianthus annuus] Length = 230 Score = 68.6 bits (166), Expect = 2e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGSSEIVFKAMGR INKTVTIVELIKRR+VGLHQI Sbjct: 13 QEKGSSEIVFKAMGRAINKTVTIVELIKRRVVGLHQI 49 >ref|XP_023757444.1| uncharacterized protein LOC111905945 [Lactuca sativa] ref|XP_023757446.1| uncharacterized protein LOC111905945 [Lactuca sativa] gb|PLY90192.1| hypothetical protein LSAT_2X7301 [Lactuca sativa] Length = 267 Score = 68.9 bits (167), Expect = 2e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGSSEIVFKAMGR INKTVTIVELIKRRIVGLHQI Sbjct: 41 QEKGSSEIVFKAMGRAINKTVTIVELIKRRIVGLHQI 77 >ref|XP_022008705.1| uncharacterized protein LOC110908109 [Helianthus annuus] Length = 258 Score = 68.6 bits (166), Expect = 3e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGSSEIVFKAMGR INKTVTIVELIKRR+VGLHQI Sbjct: 41 QEKGSSEIVFKAMGRAINKTVTIVELIKRRVVGLHQI 77 >gb|OTG04832.1| putative DNA/RNA-binding protein Alba-like protein [Helianthus annuus] Length = 302 Score = 68.9 bits (167), Expect = 3e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGSSEIVFKAMGR INKTVTIVELIKRRIVGLHQI Sbjct: 13 QEKGSSEIVFKAMGRAINKTVTIVELIKRRIVGLHQI 49 >ref|XP_021997599.1| heterogeneous nuclear ribonucleoprotein 87F-like isoform X2 [Helianthus annuus] Length = 330 Score = 68.9 bits (167), Expect = 3e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGSSEIVFKAMGR INKTVTIVELIKRRIVGLHQI Sbjct: 41 QEKGSSEIVFKAMGRAINKTVTIVELIKRRIVGLHQI 77 >ref|XP_021997596.1| translation initiation factor IF-2-like isoform X1 [Helianthus annuus] ref|XP_021997597.1| translation initiation factor IF-2-like isoform X1 [Helianthus annuus] ref|XP_021997598.1| translation initiation factor IF-2-like isoform X1 [Helianthus annuus] Length = 331 Score = 68.9 bits (167), Expect = 3e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGSSEIVFKAMGR INKTVTIVELIKRRIVGLHQI Sbjct: 41 QEKGSSEIVFKAMGRAINKTVTIVELIKRRIVGLHQI 77 >gb|PNT47286.1| hypothetical protein POPTR_002G017600v3 [Populus trichocarpa] Length = 241 Score = 67.8 bits (164), Expect = 4e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGS+EIVFKAMGR INKTVTIVELIKRRIVGLHQI Sbjct: 127 QEKGSNEIVFKAMGRAINKTVTIVELIKRRIVGLHQI 163 >ref|XP_021601813.1| ribonuclease P protein subunit p25-like protein isoform X2 [Manihot esculenta] Length = 241 Score = 67.8 bits (164), Expect = 4e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGS+EIVFKAMGR INKTVTIVELIKRRIVGLHQI Sbjct: 41 QEKGSNEIVFKAMGRAINKTVTIVELIKRRIVGLHQI 77 >ref|XP_021661123.1| ribonuclease P protein subunit p25-like protein [Hevea brasiliensis] ref|XP_021661124.1| ribonuclease P protein subunit p25-like protein [Hevea brasiliensis] Length = 247 Score = 67.8 bits (164), Expect = 5e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGS+EIVFKAMGR INKTVTIVELIKRRIVGLHQI Sbjct: 41 QEKGSNEIVFKAMGRAINKTVTIVELIKRRIVGLHQI 77 >ref|XP_021668125.1| ribonuclease P protein subunit p25-like protein [Hevea brasiliensis] ref|XP_021668126.1| ribonuclease P protein subunit p25-like protein [Hevea brasiliensis] Length = 249 Score = 67.8 bits (164), Expect = 5e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGS+EIVFKAMGR INKTVTIVELIKRRIVGLHQI Sbjct: 41 QEKGSNEIVFKAMGRAINKTVTIVELIKRRIVGLHQI 77 >ref|XP_012073732.1| ribonuclease P protein subunit p25-like protein [Jatropha curcas] gb|KDP36881.1| hypothetical protein JCGZ_08172 [Jatropha curcas] Length = 249 Score = 67.8 bits (164), Expect = 5e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGS+EIVFKAMGR INKTVTIVELIKRRIVGLHQI Sbjct: 41 QEKGSNEIVFKAMGRAINKTVTIVELIKRRIVGLHQI 77 >ref|XP_021611911.1| ribonuclease P protein subunit p25-like protein [Manihot esculenta] gb|OAY50533.1| hypothetical protein MANES_05G143700 [Manihot esculenta] Length = 250 Score = 67.8 bits (164), Expect = 5e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGS+EIVFKAMGR INKTVTIVELIKRRIVGLHQI Sbjct: 41 QEKGSNEIVFKAMGRAINKTVTIVELIKRRIVGLHQI 77 >ref|XP_011003072.1| PREDICTED: ribonuclease P protein subunit p25-like protein [Populus euphratica] ref|XP_011003073.1| PREDICTED: ribonuclease P protein subunit p25-like protein [Populus euphratica] ref|XP_011003074.1| PREDICTED: ribonuclease P protein subunit p25-like protein [Populus euphratica] Length = 250 Score = 67.8 bits (164), Expect = 5e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGS+EIVFKAMGR INKTVTIVELIKRRIVGLHQI Sbjct: 41 QEKGSNEIVFKAMGRAINKTVTIVELIKRRIVGLHQI 77 >ref|XP_021285168.1| ribonuclease P protein subunit p25-like protein [Herrania umbratica] Length = 251 Score = 67.8 bits (164), Expect = 5e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGS+EIVFKAMGR INKTVTIVELIKRRIVGLHQI Sbjct: 41 QEKGSNEIVFKAMGRAINKTVTIVELIKRRIVGLHQI 77 >ref|XP_021601812.1| ribonuclease P protein subunit p25-like protein isoform X1 [Manihot esculenta] gb|OAY22584.1| hypothetical protein MANES_18G010100 [Manihot esculenta] Length = 251 Score = 67.8 bits (164), Expect = 5e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGS+EIVFKAMGR INKTVTIVELIKRRIVGLHQI Sbjct: 41 QEKGSNEIVFKAMGRAINKTVTIVELIKRRIVGLHQI 77 >ref|XP_015887333.1| PREDICTED: ribonuclease P protein subunit p25-like protein [Ziziphus jujuba] Length = 251 Score = 67.8 bits (164), Expect = 5e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +1 Query: 229 KEKGSSEIVFKAMGRDINKTVTIVELIKRRIVGLHQI 339 +EKGS+EIVFKAMGR INKTVTIVELIKRRIVGLHQI Sbjct: 41 QEKGSNEIVFKAMGRAINKTVTIVELIKRRIVGLHQI 77