BLASTX nr result
ID: Chrysanthemum21_contig00018349
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00018349 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023731631.1| PLAT domain-containing protein 3-like [Lactu... 68 3e-11 gb|KVH95050.1| Lipase/lipooxygenase, PLAT/LH2 [Cynara cardunculu... 67 4e-11 gb|OTG10598.1| putative PLAT/LH2 domain-containing protein [Heli... 61 1e-08 >ref|XP_023731631.1| PLAT domain-containing protein 3-like [Lactuca sativa] gb|PLY75499.1| hypothetical protein LSAT_9X29700 [Lactuca sativa] Length = 188 Score = 67.8 bits (164), Expect = 3e-11 Identities = 36/49 (73%), Positives = 39/49 (79%) Frame = -1 Query: 406 QWLATDTSPYELTAIRNNCEYSSTGPRNGRQHMILESGSSSRNVVRVAK 260 QWLATDTSPYELTAIRN CEYSST R G H+ILES SSS V+R+ K Sbjct: 142 QWLATDTSPYELTAIRNYCEYSSTRSRVGGGHVILESNSSS--VLRMRK 188 >gb|KVH95050.1| Lipase/lipooxygenase, PLAT/LH2 [Cynara cardunculus var. scolymus] Length = 189 Score = 67.4 bits (163), Expect = 4e-11 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -1 Query: 406 QWLATDTSPYELTAIRNNCEYSSTGPRNGRQHMILESGSSSRNVVRVAK 260 QWLATDTSPYELTAIRN CEYS+T R G ++ILESGSS VVR+AK Sbjct: 143 QWLATDTSPYELTAIRNYCEYSATRRRAGAGNVILESGSS--YVVRMAK 189 >gb|OTG10598.1| putative PLAT/LH2 domain-containing protein [Helianthus annuus] Length = 187 Score = 60.8 bits (146), Expect = 1e-08 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = -1 Query: 406 QWLATDTSPYELTAIRNNC-EYSSTGPRNGRQHMILESGSSSRNVVRVAK 260 QWLATDTSPYELTAIRN C EYSST R+H+ILES +SS + VRVAK Sbjct: 144 QWLATDTSPYELTAIRNYCDEYSST-----RRHVILESNTSSTS-VRVAK 187