BLASTX nr result
ID: Chrysanthemum21_contig00018348
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00018348 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023731631.1| PLAT domain-containing protein 3-like [Lactu... 64 5e-10 gb|KVH95050.1| Lipase/lipooxygenase, PLAT/LH2 [Cynara cardunculu... 64 7e-10 gb|OTG10598.1| putative PLAT/LH2 domain-containing protein [Heli... 57 2e-07 >ref|XP_023731631.1| PLAT domain-containing protein 3-like [Lactuca sativa] gb|PLY75499.1| hypothetical protein LSAT_9X29700 [Lactuca sativa] Length = 188 Score = 63.9 bits (154), Expect = 5e-10 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -1 Query: 354 WLATDTSPYELTAIRNNCEYSSAGPRNGRQHMILESGSSSRNVVRVAK 211 WLATDTSPYELTAIRN CEYSS R G H+ILES SSS V+R+ K Sbjct: 143 WLATDTSPYELTAIRNYCEYSSTRSRVGGGHVILESNSSS--VLRMRK 188 >gb|KVH95050.1| Lipase/lipooxygenase, PLAT/LH2 [Cynara cardunculus var. scolymus] Length = 189 Score = 63.5 bits (153), Expect = 7e-10 Identities = 34/48 (70%), Positives = 38/48 (79%) Frame = -1 Query: 354 WLATDTSPYELTAIRNNCEYSSAGPRNGRQHMILESGSSSRNVVRVAK 211 WLATDTSPYELTAIRN CEYS+ R G ++ILESGSS VVR+AK Sbjct: 144 WLATDTSPYELTAIRNYCEYSATRRRAGAGNVILESGSS--YVVRMAK 189 >gb|OTG10598.1| putative PLAT/LH2 domain-containing protein [Helianthus annuus] Length = 187 Score = 57.0 bits (136), Expect = 2e-07 Identities = 34/49 (69%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Frame = -1 Query: 354 WLATDTSPYELTAIRNNC-EYSSAGPRNGRQHMILESGSSSRNVVRVAK 211 WLATDTSPYELTAIRN C EYSS R+H+ILES +SS + VRVAK Sbjct: 145 WLATDTSPYELTAIRNYCDEYSST-----RRHVILESNTSSTS-VRVAK 187