BLASTX nr result
ID: Chrysanthemum21_contig00018225
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00018225 (1496 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO75849.1| hypothetical protein CISIN_1g0117381mg, partial [... 56 4e-06 >gb|KDO75849.1| hypothetical protein CISIN_1g0117381mg, partial [Citrus sinensis] Length = 116 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/37 (67%), Positives = 28/37 (75%) Frame = -2 Query: 646 SGDTDGRAHVLSKIYSLRSLGLHIAKTWKPWYNQKHV 536 SGDTDGR VLS Y L SLGL I K+W+PWY+QK V Sbjct: 76 SGDTDGRVPVLSTRYCLNSLGLSITKSWRPWYHQKQV 112