BLASTX nr result
ID: Chrysanthemum21_contig00018054
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00018054 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AIP90174.1| fructan 1-exohydrolase IIb [Cichorium intybus] 54 6e-06 gb|AIP90173.1| fructan 1-exohydrolase IIb [Cichorium intybus] 54 6e-06 emb|CAC37923.1| fructan 1-exohydrolase IIb [Cichorium intybus] 54 6e-06 >gb|AIP90174.1| fructan 1-exohydrolase IIb [Cichorium intybus] Length = 578 Score = 54.3 bits (129), Expect = 6e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 230 PVEEIELLRENEVKLENKNLKPGSILAIMGLIVSQA 337 PVEEIE LR+NEV L+NKNLKPGS+L I G+ SQA Sbjct: 365 PVEEIEELRQNEVNLKNKNLKPGSVLEIHGITASQA 400 >gb|AIP90173.1| fructan 1-exohydrolase IIb [Cichorium intybus] Length = 581 Score = 54.3 bits (129), Expect = 6e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +2 Query: 230 PVEEIELLRENEVKLENKNLKPGSILAIMGLIVSQA 337 P+EEIE LR+NEV L+NKNLKPGS+L I G+ SQA Sbjct: 368 PIEEIEELRQNEVNLQNKNLKPGSVLEIHGITASQA 403 >emb|CAC37923.1| fructan 1-exohydrolase IIb [Cichorium intybus] Length = 581 Score = 54.3 bits (129), Expect = 6e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +2 Query: 230 PVEEIELLRENEVKLENKNLKPGSILAIMGLIVSQA 337 P+EEIE LR+NEV L+NKNLKPGS+L I G+ SQA Sbjct: 368 PIEEIEELRQNEVNLQNKNLKPGSVLEIHGITASQA 403