BLASTX nr result
ID: Chrysanthemum21_contig00017970
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00017970 (391 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI09542.1| protein of unknown function DUF4005 [Cynara cardu... 58 3e-07 >gb|KVI09542.1| protein of unknown function DUF4005 [Cynara cardunculus var. scolymus] Length = 354 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 175 MCQG*WVDDTAMGRKGNWISSIKKALSPSSKEKKGQ 68 M G VDDT MGRKGNW+SSIKKALSPSSKEK+ Q Sbjct: 1 MFAGYSVDDTVMGRKGNWLSSIKKALSPSSKEKRSQ 36