BLASTX nr result
ID: Chrysanthemum21_contig00017772
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00017772 (377 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022035725.1| exocyst complex component SEC10b [Helianthus... 55 5e-06 gb|OTG29306.1| putative exocyst complex component sec10 [Heliant... 55 5e-06 gb|OIT27488.1| exocyst complex component sec10 [Nicotiana attenu... 51 8e-06 >ref|XP_022035725.1| exocyst complex component SEC10b [Helianthus annuus] Length = 824 Score = 54.7 bits (130), Expect = 5e-06 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -1 Query: 377 SLFEGTPSILKDAQRFIQLREDYXXXXXXXXXXXLWPSS 261 SLFEGTPSILKDAQRFIQLREDY LWPSS Sbjct: 786 SLFEGTPSILKDAQRFIQLREDYKSAKLAAKLSSLWPSS 824 >gb|OTG29306.1| putative exocyst complex component sec10 [Helianthus annuus] Length = 877 Score = 54.7 bits (130), Expect = 5e-06 Identities = 28/39 (71%), Positives = 28/39 (71%) Frame = -1 Query: 377 SLFEGTPSILKDAQRFIQLREDYXXXXXXXXXXXLWPSS 261 SLFEGTPSILKDAQRFIQLREDY LWPSS Sbjct: 839 SLFEGTPSILKDAQRFIQLREDYKSAKLAAKLSSLWPSS 877 >gb|OIT27488.1| exocyst complex component sec10 [Nicotiana attenuata] Length = 102 Score = 51.2 bits (121), Expect = 8e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = -1 Query: 377 SLFEGTPSILKDAQRFIQLREDYXXXXXXXXXXXLWPSS 261 +LFEGTPSI KDAQRFIQLREDY LWPSS Sbjct: 63 TLFEGTPSIRKDAQRFIQLREDYKSAKLAARLSSLWPSS 101