BLASTX nr result
ID: Chrysanthemum21_contig00017758
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00017758 (618 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY14610.1| calcium-binding protein 39-like, partial [Trifoli... 57 3e-06 ref|XP_023737164.1| calcium-binding protein 39 [Lactuca sativa] 57 4e-06 gb|PLY71218.1| hypothetical protein LSAT_6X14801 [Lactuca sativa] 57 5e-06 ref|XP_023006027.1| calcium-binding protein 39 [Cucurbita maxima] 56 8e-06 ref|XP_002315537.2| hypothetical protein POPTR_0010s02960g, part... 55 1e-05 >gb|PNY14610.1| calcium-binding protein 39-like, partial [Trifolium pratense] Length = 344 Score = 57.4 bits (137), Expect = 3e-06 Identities = 28/36 (77%), Positives = 34/36 (94%), Gaps = 1/36 (2%) Frame = +1 Query: 514 YSLTSF-QFFEQYETLLTSSNYVTRRQSLKLLSEFL 618 +S+TS+ QFF+QYETLLTS NYVTRRQS+KLLS+FL Sbjct: 225 HSMTSYSQFFDQYETLLTSPNYVTRRQSIKLLSDFL 260 >ref|XP_023737164.1| calcium-binding protein 39 [Lactuca sativa] Length = 345 Score = 57.0 bits (136), Expect = 4e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 532 QFFEQYETLLTSSNYVTRRQSLKLLSEFL 618 +FFEQYETLLTS+NYVTRRQSLKLLSEFL Sbjct: 212 EFFEQYETLLTSNNYVTRRQSLKLLSEFL 240 >gb|PLY71218.1| hypothetical protein LSAT_6X14801 [Lactuca sativa] Length = 351 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 532 QFFEQYETLLTSSNYVTRRQSLKLLSEFL 618 +FFEQYETLLTS+NYVTRRQSLKLLSEFL Sbjct: 212 EFFEQYETLLTSNNYVTRRQSLKLLSEFL 240 >ref|XP_023006027.1| calcium-binding protein 39 [Cucurbita maxima] Length = 345 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 505 SSIYSLTSFQFFEQYETLLTSSNYVTRRQSLKLLSEFL 618 S+ S +FF++YETLLTSSNYVTRRQSLKLLSEFL Sbjct: 203 SNFLSAHYVEFFDRYETLLTSSNYVTRRQSLKLLSEFL 240 >ref|XP_002315537.2| hypothetical protein POPTR_0010s02960g, partial [Populus trichocarpa] gb|PNS22524.1| hypothetical protein POPTR_T137800v3, partial [Populus trichocarpa] Length = 184 Score = 54.7 bits (130), Expect = 1e-05 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 532 QFFEQYETLLTSSNYVTRRQSLKLLSEFL 618 +FF+QYE LLTSSNYVTRRQSLKLLSEFL Sbjct: 51 EFFDQYEKLLTSSNYVTRRQSLKLLSEFL 79