BLASTX nr result
ID: Chrysanthemum21_contig00017669
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00017669 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI10014.1| Zinc finger, RING/FYVE/PHD-type [Cynara carduncul... 61 5e-08 ref|XP_021974055.1| U-box domain-containing protein 62-like isof... 60 1e-07 ref|XP_021974054.1| U-box domain-containing protein 62-like isof... 60 1e-07 ref|XP_023736106.1| U-box domain-containing protein 62-like [Lac... 59 5e-07 >gb|KVI10014.1| Zinc finger, RING/FYVE/PHD-type [Cynara cardunculus var. scolymus] Length = 439 Score = 61.2 bits (147), Expect = 5e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 166 ITVADPTGEMYYSQYLQGVEGSGAGFKEMMVDNG 65 ITVADP GE+YYSQYL+G EGSGAG K+M+V+NG Sbjct: 206 ITVADPNGELYYSQYLRGAEGSGAGLKDMLVENG 239 >ref|XP_021974055.1| U-box domain-containing protein 62-like isoform X2 [Helianthus annuus] gb|OTG21433.1| putative zinc finger, RING/FYVE/PHD-type [Helianthus annuus] Length = 420 Score = 60.1 bits (144), Expect = 1e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 166 ITVADPTGEMYYSQYLQGVEGSGAGFKEMMVDNG 65 ITVADP GE+YYSQ GVEGSGAGFK+M+V+NG Sbjct: 187 ITVADPNGELYYSQLFNGVEGSGAGFKDMLVENG 220 >ref|XP_021974054.1| U-box domain-containing protein 62-like isoform X1 [Helianthus annuus] Length = 451 Score = 60.1 bits (144), Expect = 1e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 166 ITVADPTGEMYYSQYLQGVEGSGAGFKEMMVDNG 65 ITVADP GE+YYSQ GVEGSGAGFK+M+V+NG Sbjct: 187 ITVADPNGELYYSQLFNGVEGSGAGFKDMLVENG 220 >ref|XP_023736106.1| U-box domain-containing protein 62-like [Lactuca sativa] gb|PLY72039.1| hypothetical protein LSAT_2X126241 [Lactuca sativa] Length = 437 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = -1 Query: 166 ITVADPTGEMYYSQYLQGVEGS-GAGFKEMMVDNG 65 IT+ADPTGE+YYSQYLQG+EGS GAG K+++V+NG Sbjct: 197 ITIADPTGELYYSQYLQGMEGSGGAGIKDILVENG 231