BLASTX nr result
ID: Chrysanthemum21_contig00017666
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00017666 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PHU18358.1| 26S proteasome non-ATPase regulatory subunit 13 -... 92 6e-22 ref|XP_009794951.1| PREDICTED: 26S proteasome non-ATPase regulat... 94 2e-21 emb|CBI33798.3| unnamed protein product, partial [Vitis vinifera] 93 3e-21 ref|XP_023750174.1| 26S proteasome non-ATPase regulatory subunit... 97 3e-21 gb|KVH95163.1| Proteasome component (PCI) domain-containing prot... 97 3e-21 ref|XP_010677476.1| PREDICTED: 26S proteasome non-ATPase regulat... 96 8e-21 ref|XP_019242914.1| PREDICTED: 26S proteasome non-ATPase regulat... 92 1e-20 ref|XP_021969891.1| 26S proteasome non-ATPase regulatory subunit... 95 2e-20 gb|KDO58795.1| hypothetical protein CISIN_1g0437802mg, partial [... 94 2e-20 ref|XP_022001229.1| 26S proteasome non-ATPase regulatory subunit... 94 2e-20 ref|XP_010942740.1| PREDICTED: 26S proteasome non-ATPase regulat... 94 2e-20 gb|KVH91664.1| Proteasome component (PCI) domain-containing prot... 94 2e-20 ref|XP_023739463.1| 26S proteasome non-ATPase regulatory subunit... 94 3e-20 ref|XP_015897310.1| PREDICTED: 26S proteasome non-ATPase regulat... 94 3e-20 ref|XP_006432662.1| 26S proteasome non-ATPase regulatory subunit... 94 3e-20 ref|XP_011074603.1| LOW QUALITY PROTEIN: 26S proteasome non-ATPa... 94 4e-20 ref|XP_016455629.1| PREDICTED: 26S proteasome non-ATPase regulat... 94 4e-20 ref|XP_012847172.1| PREDICTED: 26S proteasome non-ATPase regulat... 94 4e-20 gb|ADE77761.1| unknown [Picea sitchensis] 87 5e-20 gb|OMO93482.1| hypothetical protein COLO4_16915 [Corchorus olito... 93 5e-20 >gb|PHU18358.1| 26S proteasome non-ATPase regulatory subunit 13 -like protein B [Capsicum chinense] Length = 81 Score = 91.7 bits (226), Expect = 6e-22 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTV+VSWVQPRVLGIPQIKSLRDRLD WV KVHTAL SVEAETPDLVA+ Sbjct: 33 GTVHVSWVQPRVLGIPQIKSLRDRLDSWVDKVHTALLSVEAETPDLVAA 81 >ref|XP_009794951.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B-like, partial [Nicotiana sylvestris] Length = 192 Score = 93.6 bits (231), Expect = 2e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTVYVSWVQPRVLGIPQIKSLRDRLD WV KVHTAL SVEAETPDLVA+ Sbjct: 144 GTVYVSWVQPRVLGIPQIKSLRDRLDNWVDKVHTALLSVEAETPDLVAT 192 >emb|CBI33798.3| unnamed protein product, partial [Vitis vinifera] Length = 181 Score = 92.8 bits (229), Expect = 3e-21 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTV+VSWVQPRVLGIPQIKSLRDRLD WV KVHTAL SVEAETPDLVAS Sbjct: 133 GTVHVSWVQPRVLGIPQIKSLRDRLDNWVDKVHTALLSVEAETPDLVAS 181 >ref|XP_023750174.1| 26S proteasome non-ATPase regulatory subunit 13 homolog B [Lactuca sativa] gb|PLY95782.1| hypothetical protein LSAT_3X21060 [Lactuca sativa] Length = 386 Score = 96.7 bits (239), Expect = 3e-21 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTVYVSWVQPRVLGI QIKSLRDRLDGWVGKVHTAL SVEAETPDLVAS Sbjct: 338 GTVYVSWVQPRVLGIAQIKSLRDRLDGWVGKVHTALLSVEAETPDLVAS 386 >gb|KVH95163.1| Proteasome component (PCI) domain-containing protein [Cynara cardunculus var. scolymus] Length = 386 Score = 96.7 bits (239), Expect = 3e-21 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTVYVSWVQPRVLGI QIKSLRDRLDGWVGKVHTAL SVEAETPDLVAS Sbjct: 338 GTVYVSWVQPRVLGISQIKSLRDRLDGWVGKVHTALISVEAETPDLVAS 386 >ref|XP_010677476.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B [Beta vulgaris subsp. vulgaris] gb|KMT11459.1| hypothetical protein BVRB_5g107830 [Beta vulgaris subsp. vulgaris] Length = 386 Score = 95.5 bits (236), Expect = 8e-21 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTV+VSWVQPRVLGIPQIKSLRDRLD WVGKVHTAL SVEAETPDLVAS Sbjct: 338 GTVHVSWVQPRVLGIPQIKSLRDRLDNWVGKVHTALLSVEAETPDLVAS 386 >ref|XP_019242914.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B-like [Nicotiana attenuata] Length = 200 Score = 91.7 bits (226), Expect = 1e-20 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTV+VSWVQPRVLGIPQIKSLRDRLD WV KVHTAL SVEAETPDLVA+ Sbjct: 152 GTVHVSWVQPRVLGIPQIKSLRDRLDNWVDKVHTALLSVEAETPDLVAT 200 >ref|XP_021969891.1| 26S proteasome non-ATPase regulatory subunit 13 homolog A [Helianthus annuus] gb|OTG22564.1| putative proteasome component (PCI) domain protein [Helianthus annuus] Length = 386 Score = 94.7 bits (234), Expect = 2e-20 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTVYVSWVQPRVLGI QIKSLRDRLDGWVG+VHTAL SVEAETPDLVA+ Sbjct: 338 GTVYVSWVQPRVLGISQIKSLRDRLDGWVGRVHTALVSVEAETPDLVAT 386 >gb|KDO58795.1| hypothetical protein CISIN_1g0437802mg, partial [Citrus sinensis] Length = 336 Score = 94.0 bits (232), Expect = 2e-20 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTV+VSWVQPRVLGIPQIKSLRDRLD W+GKVHTAL S+EAETPDLVAS Sbjct: 288 GTVHVSWVQPRVLGIPQIKSLRDRLDSWLGKVHTALLSIEAETPDLVAS 336 >ref|XP_022001229.1| 26S proteasome non-ATPase regulatory subunit 13 homolog B-like [Helianthus annuus] gb|OTG01697.1| putative 26S proteasome non-ATPase regulatory subunit 13 [Helianthus annuus] Length = 386 Score = 94.4 bits (233), Expect = 2e-20 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTVYVSWVQPRVLGI QIKSLRDRLD WVGKVHTAL SVEAETPDL+AS Sbjct: 338 GTVYVSWVQPRVLGISQIKSLRDRLDNWVGKVHTALVSVEAETPDLIAS 386 >ref|XP_010942740.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B [Elaeis guineensis] Length = 387 Score = 94.4 bits (233), Expect = 2e-20 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTV+VSWVQPRVLGIPQIKSLRDRLD W+GKVHTAL SVEAETPDLVAS Sbjct: 339 GTVHVSWVQPRVLGIPQIKSLRDRLDNWLGKVHTALLSVEAETPDLVAS 387 >gb|KVH91664.1| Proteasome component (PCI) domain-containing protein [Cynara cardunculus var. scolymus] Length = 358 Score = 94.0 bits (232), Expect = 2e-20 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTVY+SWVQPRVLGI QIKSLRDRLD WVGKVHTAL SVEAETPDLVAS Sbjct: 310 GTVYISWVQPRVLGITQIKSLRDRLDNWVGKVHTALISVEAETPDLVAS 358 >ref|XP_023739463.1| 26S proteasome non-ATPase regulatory subunit 13 homolog A-like [Lactuca sativa] gb|PLY69444.1| hypothetical protein LSAT_6X73301 [Lactuca sativa] Length = 386 Score = 94.0 bits (232), Expect = 3e-20 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTVYVSWVQPRVLG+ QIKSLRDRLD WVGKVHTAL SVEAETPDLVAS Sbjct: 338 GTVYVSWVQPRVLGVAQIKSLRDRLDNWVGKVHTALISVEAETPDLVAS 386 >ref|XP_015897310.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog A [Ziziphus jujuba] ref|XP_015868323.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog A [Ziziphus jujuba] Length = 386 Score = 94.0 bits (232), Expect = 3e-20 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTV+VSWVQPRVLGIPQIKSLRDRLD W+GKVHTAL S+EAETPDLVAS Sbjct: 338 GTVHVSWVQPRVLGIPQIKSLRDRLDNWLGKVHTALLSIEAETPDLVAS 386 >ref|XP_006432662.1| 26S proteasome non-ATPase regulatory subunit 13 homolog B [Citrus clementina] ref|XP_006471468.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B [Citrus sinensis] gb|ESR45902.1| hypothetical protein CICLE_v10001468mg [Citrus clementina] dbj|GAY60892.1| hypothetical protein CUMW_205630 [Citrus unshiu] Length = 386 Score = 94.0 bits (232), Expect = 3e-20 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTV+VSWVQPRVLGIPQIKSLRDRLD W+GKVHTAL S+EAETPDLVAS Sbjct: 338 GTVHVSWVQPRVLGIPQIKSLRDRLDSWLGKVHTALLSIEAETPDLVAS 386 >ref|XP_011074603.1| LOW QUALITY PROTEIN: 26S proteasome non-ATPase regulatory subunit 13 homolog A [Sesamum indicum] Length = 373 Score = 93.6 bits (231), Expect = 4e-20 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTVYVSWVQPRVLGIPQIKSLRDRLD WV KVHTAL SVEAETPDLVA+ Sbjct: 325 GTVYVSWVQPRVLGIPQIKSLRDRLDNWVDKVHTALLSVEAETPDLVAA 373 >ref|XP_016455629.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog B-like [Nicotiana tabacum] Length = 386 Score = 93.6 bits (231), Expect = 4e-20 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTVYVSWVQPRVLGIPQIKSLRDRLD WV KVHTAL SVEAETPDLVA+ Sbjct: 338 GTVYVSWVQPRVLGIPQIKSLRDRLDNWVDKVHTALLSVEAETPDLVAT 386 >ref|XP_012847172.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 13 homolog A [Erythranthe guttata] gb|EYU29068.1| hypothetical protein MIMGU_mgv1a008043mg [Erythranthe guttata] Length = 386 Score = 93.6 bits (231), Expect = 4e-20 Identities = 45/49 (91%), Positives = 46/49 (93%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTVYVSWVQPRVLGIPQIKSLRDRLD WV KVHTAL SVEAETPDLVA+ Sbjct: 338 GTVYVSWVQPRVLGIPQIKSLRDRLDNWVDKVHTALLSVEAETPDLVAA 386 >gb|ADE77761.1| unknown [Picea sitchensis] Length = 100 Score = 87.4 bits (215), Expect = 5e-20 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTV+VSWVQPRVLGIPQIKSLRD+LD W+ KVHT L +VEAETPDLVAS Sbjct: 52 GTVHVSWVQPRVLGIPQIKSLRDKLDNWLQKVHTTLLAVEAETPDLVAS 100 >gb|OMO93482.1| hypothetical protein COLO4_16915 [Corchorus olitorius] Length = 342 Score = 92.8 bits (229), Expect = 5e-20 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +1 Query: 1 GTVYVSWVQPRVLGIPQIKSLRDRLDGWVGKVHTALTSVEAETPDLVAS 147 GTV+VSWVQPRVLGIPQIKSLRDRLD WVGKVHTA S+EAETPDLVAS Sbjct: 294 GTVHVSWVQPRVLGIPQIKSLRDRLDSWVGKVHTAWLSIEAETPDLVAS 342