BLASTX nr result
ID: Chrysanthemum21_contig00017580
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00017580 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI12285.1| hypothetical protein Ccrd_009287 [Cynara carduncu... 50 9e-06 >gb|KVI12285.1| hypothetical protein Ccrd_009287 [Cynara cardunculus var. scolymus] Length = 175 Score = 49.7 bits (117), Expect(2) = 9e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -2 Query: 318 SVERNEMMEGVNKLQGVCRESVIEGGSATTDVDRFIRN 205 S E EMME V K++GVCR SV EGGSAT ++D FIR+ Sbjct: 124 SDESKEMMERVKKVKGVCRVSVSEGGSATREIDSFIRD 161 Score = 27.3 bits (59), Expect(2) = 9e-06 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -1 Query: 370 LVKREEIVAVVRRFMDLE 317 +V R EI AVVRRFMD E Sbjct: 106 VVARAEIAAVVRRFMDRE 123