BLASTX nr result
ID: Chrysanthemum21_contig00017400
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00017400 (483 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021996487.1| mechanosensitive ion channel protein 10-like... 67 5e-10 ref|XP_021996486.1| mechanosensitive ion channel protein 10-like... 67 5e-10 ref|XP_023744437.1| mechanosensitive ion channel protein 10-like... 66 1e-09 ref|XP_023744436.1| mechanosensitive ion channel protein 10-like... 66 1e-09 ref|XP_023744435.1| mechanosensitive ion channel protein 10-like... 66 1e-09 gb|KVH94027.1| Like-Sm (LSM) domain-containing protein, partial ... 65 2e-09 gb|KJB65265.1| hypothetical protein B456_010G086800 [Gossypium r... 59 3e-07 gb|KJB65266.1| hypothetical protein B456_010G086800 [Gossypium r... 59 3e-07 gb|PPD95702.1| hypothetical protein GOBAR_DD07258 [Gossypium bar... 59 3e-07 gb|KJB65267.1| hypothetical protein B456_010G086800 [Gossypium r... 59 3e-07 ref|XP_016682416.1| PREDICTED: mechanosensitive ion channel prot... 59 3e-07 ref|XP_016678727.1| PREDICTED: mechanosensitive ion channel prot... 59 3e-07 ref|XP_021277667.1| mechanosensitive ion channel protein 10-like... 59 3e-07 ref|XP_017982088.1| PREDICTED: mechanosensitive ion channel prot... 59 3e-07 gb|EOY30310.1| Mechanosensitive channel of small conductance-lik... 59 3e-07 dbj|GAU27988.1| hypothetical protein TSUD_373830 [Trifolium subt... 59 4e-07 dbj|GAU27987.1| hypothetical protein TSUD_373820 [Trifolium subt... 59 4e-07 gb|PNX91944.1| mechanosensitive ion channel protein 10-like, par... 59 4e-07 ref|XP_022636175.1| mechanosensitive ion channel protein 10-like... 59 4e-07 ref|XP_014500255.1| mechanosensitive ion channel protein 10-like... 59 5e-07 >ref|XP_021996487.1| mechanosensitive ion channel protein 10-like isoform X2 [Helianthus annuus] Length = 695 Score = 67.4 bits (163), Expect = 5e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 +YPN+ILATKAISNFNRSPEMSDS+EFDLDVSTS Sbjct: 618 YYPNSILATKAISNFNRSPEMSDSVEFDLDVSTS 651 >ref|XP_021996486.1| mechanosensitive ion channel protein 10-like isoform X1 [Helianthus annuus] gb|OTG03704.1| putative mechanosensitive ion channel MscS, LSM domain protein [Helianthus annuus] Length = 756 Score = 67.4 bits (163), Expect = 5e-10 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 +YPN+ILATKAISNFNRSPEMSDS+EFDLDVSTS Sbjct: 618 YYPNSILATKAISNFNRSPEMSDSVEFDLDVSTS 651 >ref|XP_023744437.1| mechanosensitive ion channel protein 10-like isoform X3 [Lactuca sativa] Length = 655 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 +YPN+ILATKAISNFNRSPEMSDS+EFD+DVSTS Sbjct: 583 YYPNSILATKAISNFNRSPEMSDSVEFDVDVSTS 616 >ref|XP_023744436.1| mechanosensitive ion channel protein 10-like isoform X2 [Lactuca sativa] Length = 720 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 +YPN+ILATKAISNFNRSPEMSDS+EFD+DVSTS Sbjct: 582 YYPNSILATKAISNFNRSPEMSDSVEFDVDVSTS 615 >ref|XP_023744435.1| mechanosensitive ion channel protein 10-like isoform X1 [Lactuca sativa] gb|PLY65666.1| hypothetical protein LSAT_5X141920 [Lactuca sativa] Length = 721 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 +YPN+ILATKAISNFNRSPEMSDS+EFD+DVSTS Sbjct: 583 YYPNSILATKAISNFNRSPEMSDSVEFDVDVSTS 616 >gb|KVH94027.1| Like-Sm (LSM) domain-containing protein, partial [Cynara cardunculus var. scolymus] Length = 812 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 FYPN+ILA KAISNFNRSPEMSDSIEFD+DVSTS Sbjct: 633 FYPNSILAMKAISNFNRSPEMSDSIEFDVDVSTS 666 >gb|KJB65265.1| hypothetical protein B456_010G086800 [Gossypium raimondii] Length = 405 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 FYPN++LATK ISNF RSPEMSDS+EF +DVSTS Sbjct: 269 FYPNSVLATKPISNFYRSPEMSDSVEFTVDVSTS 302 >gb|KJB65266.1| hypothetical protein B456_010G086800 [Gossypium raimondii] Length = 600 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 FYPN++LATK ISNF RSPEMSDS+EF +DVSTS Sbjct: 464 FYPNSVLATKPISNFYRSPEMSDSVEFTVDVSTS 497 >gb|PPD95702.1| hypothetical protein GOBAR_DD07258 [Gossypium barbadense] gb|PPR83107.1| hypothetical protein GOBAR_AA37605 [Gossypium barbadense] Length = 653 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 FYPN++LATK ISNF RSPEMSDS+EF +DVSTS Sbjct: 491 FYPNSVLATKPISNFYRSPEMSDSVEFTVDVSTS 524 >gb|KJB65267.1| hypothetical protein B456_010G086800 [Gossypium raimondii] Length = 755 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 FYPN++LATK ISNF RSPEMSDS+EF +DVSTS Sbjct: 619 FYPNSVLATKPISNFYRSPEMSDSVEFTVDVSTS 652 >ref|XP_016682416.1| PREDICTED: mechanosensitive ion channel protein 10-like [Gossypium hirsutum] Length = 767 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 FYPN++LATK ISNF RSPEMSDS+EF +DVSTS Sbjct: 631 FYPNSVLATKPISNFYRSPEMSDSVEFTVDVSTS 664 >ref|XP_016678727.1| PREDICTED: mechanosensitive ion channel protein 10-like [Gossypium hirsutum] Length = 768 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 FYPN++LATK ISNF RSPEMSDS+EF +DVSTS Sbjct: 632 FYPNSVLATKPISNFYRSPEMSDSVEFTVDVSTS 665 >ref|XP_021277667.1| mechanosensitive ion channel protein 10-like [Herrania umbratica] Length = 784 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 FYPN++LATK ISNF RSPEMSDS+EF +DVSTS Sbjct: 647 FYPNSVLATKPISNFYRSPEMSDSVEFTVDVSTS 680 >ref|XP_017982088.1| PREDICTED: mechanosensitive ion channel protein 10 [Theobroma cacao] Length = 784 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 FYPN++LATK ISNF RSPEMSDS+EF +DVSTS Sbjct: 647 FYPNSVLATKPISNFYRSPEMSDSVEFTVDVSTS 680 >gb|EOY30310.1| Mechanosensitive channel of small conductance-like 10, putative isoform 1 [Theobroma cacao] Length = 949 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 FYPN++LATK ISNF RSPEMSDS+EF +DVSTS Sbjct: 647 FYPNSVLATKPISNFYRSPEMSDSVEFTVDVSTS 680 >dbj|GAU27988.1| hypothetical protein TSUD_373830 [Trifolium subterraneum] Length = 475 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 FYPN++LATK ISNF RSPEMSDS+EF +DVSTS Sbjct: 429 FYPNSVLATKPISNFYRSPEMSDSVEFAVDVSTS 462 >dbj|GAU27987.1| hypothetical protein TSUD_373820 [Trifolium subterraneum] Length = 516 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 FYPN++LATK ISNF RSPEMSDS+EF +DVSTS Sbjct: 387 FYPNSVLATKPISNFYRSPEMSDSVEFAVDVSTS 420 >gb|PNX91944.1| mechanosensitive ion channel protein 10-like, partial [Trifolium pratense] Length = 560 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 FYPN++LATK ISNF RSPEMSDS+EF +DVSTS Sbjct: 437 FYPNSVLATKPISNFYRSPEMSDSVEFAVDVSTS 470 >ref|XP_022636175.1| mechanosensitive ion channel protein 10-like isoform X2 [Vigna radiata var. radiata] Length = 684 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 FYPN++LATK ISNF RSPEMSDS+EF +DVSTS Sbjct: 550 FYPNSVLATKPISNFYRSPEMSDSVEFAVDVSTS 583 >ref|XP_014500255.1| mechanosensitive ion channel protein 10-like isoform X1 [Vigna radiata var. radiata] Length = 742 Score = 58.9 bits (141), Expect = 5e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 FYPNAILATKAISNFNRSPEMSDSIEFDLDVSTS 102 FYPN++LATK ISNF RSPEMSDS+EF +DVSTS Sbjct: 608 FYPNSVLATKPISNFYRSPEMSDSVEFAVDVSTS 641