BLASTX nr result
ID: Chrysanthemum21_contig00017304
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00017304 (618 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG37543.1| putative nucleotide-binding alpha-beta plait doma... 79 2e-13 dbj|GAV71505.1| RRM_1 domain-containing protein [Cephalotus foll... 70 1e-10 gb|KJB38875.1| hypothetical protein B456_007G0851001 [Gossypium ... 68 1e-09 gb|KVI00550.1| Nucleotide-binding, alpha-beta plait [Cynara card... 65 1e-08 ref|XP_002270340.2| PREDICTED: nucleolin [Vitis vinifera] >gi|73... 61 3e-07 gb|OAY49444.1| hypothetical protein MANES_05G056900 [Manihot esc... 59 1e-06 ref|XP_022865998.1| nucleolin-like [Olea europaea var. sylvestri... 59 1e-06 ref|XP_021613170.1| nucleolin isoform X1 [Manihot esculenta] >gi... 59 1e-06 ref|XP_021910910.1| uncharacterized protein LOC110824690 [Carica... 58 2e-06 gb|KHG08446.1| hypothetical protein F383_35471 [Gossypium arboreum] 58 2e-06 ref|XP_016544248.1| PREDICTED: uncharacterized protein LOC107844... 59 2e-06 gb|KDO85461.1| hypothetical protein CISIN_1g0040411mg, partial [... 59 2e-06 gb|KDO85458.1| hypothetical protein CISIN_1g0040411mg, partial [... 59 2e-06 gb|KDO85456.1| hypothetical protein CISIN_1g0040411mg, partial [... 59 2e-06 dbj|GAY57860.1| hypothetical protein CUMW_182710 [Citrus unshiu] 59 2e-06 ref|NP_001275825.1| RNA recognition motif protein 1 [Citrus sine... 59 2e-06 ref|XP_015387018.1| PREDICTED: RNA recognition motif protein 1 i... 59 2e-06 ref|XP_006445454.1| heterogeneous nuclear ribonucleoprotein Q is... 59 2e-06 ref|XP_015386938.1| PREDICTED: RNA recognition motif protein 1 i... 59 2e-06 gb|KJB38879.1| hypothetical protein B456_007G0851001, partial [G... 58 2e-06 >gb|OTG37543.1| putative nucleotide-binding alpha-beta plait domain-containing protein [Helianthus annuus] Length = 855 Score = 78.6 bits (192), Expect = 2e-13 Identities = 45/69 (65%), Positives = 49/69 (71%), Gaps = 8/69 (11%) Frame = +2 Query: 434 LGRSNIG--YGSSRGSMSAQDSHGLYSS--HQGMAYSG----VAVNLVACTHQAMAVITY 589 +GRSNIG YG SR SMS QDSHGLYSS QGM+Y V V + CTH+AMAVITY Sbjct: 726 IGRSNIGGGYGGSRSSMSGQDSHGLYSSSSRQGMSYGRGALTVVVRVAVCTHRAMAVITY 785 Query: 590 LVAVMLAEA 616 LV VML EA Sbjct: 786 LVVVMLVEA 794 >dbj|GAV71505.1| RRM_1 domain-containing protein [Cephalotus follicularis] Length = 785 Score = 70.5 bits (171), Expect = 1e-10 Identities = 39/62 (62%), Positives = 43/62 (69%), Gaps = 4/62 (6%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG----VAVNLVACTHQAMAVITYLVAV 601 LGRSN+GYGSSR +MS QDSHGLYS+ QGM Y G V LV T QAM IT LV + Sbjct: 693 LGRSNMGYGSSRSTMSGQDSHGLYSNRQGMGYGGEVLLVVGKLVDYTLQAMEAITCLVEM 752 Query: 602 ML 607 ML Sbjct: 753 ML 754 >gb|KJB38875.1| hypothetical protein B456_007G0851001 [Gossypium raimondii] Length = 814 Score = 67.8 bits (164), Expect = 1e-09 Identities = 39/66 (59%), Positives = 44/66 (66%), Gaps = 5/66 (7%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG----VAVNLVACTHQ-AMAVITYLVA 598 LGRSN+GYG SR S+S+QDSHGLY+S QGM Y G AV LV CT M VIT L Sbjct: 697 LGRSNLGYGGSRSSISSQDSHGLYASRQGMGYGGGVRLAAVILVECTRPLVMVVITCLGD 756 Query: 599 VMLAEA 616 +ML A Sbjct: 757 LMLVVA 762 >gb|KVI00550.1| Nucleotide-binding, alpha-beta plait [Cynara cardunculus var. scolymus] Length = 781 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG 535 LGRSNIGYGSSR SMSAQDSHGLYSS QG+AY G Sbjct: 691 LGRSNIGYGSSRSSMSAQDSHGLYSSRQGLAYGG 724 >ref|XP_002270340.2| PREDICTED: nucleolin [Vitis vinifera] ref|XP_010661414.1| PREDICTED: nucleolin [Vitis vinifera] emb|CBI16691.3| unnamed protein product, partial [Vitis vinifera] Length = 812 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG 535 LGRSN+GYG SR SMS+QDSHGLYSS QGM Y G Sbjct: 723 LGRSNLGYGGSRSSMSSQDSHGLYSSRQGMGYGG 756 >gb|OAY49444.1| hypothetical protein MANES_05G056900 [Manihot esculenta] Length = 765 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG 535 +GRSN+GYG SR S+S+QDSHGLYSS QGM+Y G Sbjct: 695 IGRSNVGYGGSRSSISSQDSHGLYSSRQGMSYGG 728 >ref|XP_022865998.1| nucleolin-like [Olea europaea var. sylvestris] ref|XP_022866003.1| nucleolin-like [Olea europaea var. sylvestris] Length = 776 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG 535 LGRSN+GYG SR S+S+QDSHG+YSS QGM+Y G Sbjct: 687 LGRSNLGYGGSRSSLSSQDSHGIYSSRQGMSYGG 720 >ref|XP_021613170.1| nucleolin isoform X1 [Manihot esculenta] ref|XP_021613171.1| nucleolin isoform X1 [Manihot esculenta] ref|XP_021613172.1| nucleolin isoform X1 [Manihot esculenta] gb|OAY49445.1| hypothetical protein MANES_05G056900 [Manihot esculenta] Length = 780 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG 535 +GRSN+GYG SR S+S+QDSHGLYSS QGM+Y G Sbjct: 695 IGRSNVGYGGSRSSISSQDSHGLYSSRQGMSYGG 728 >ref|XP_021910910.1| uncharacterized protein LOC110824690 [Carica papaya] Length = 252 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG 535 LGRS++GYGSSR SMS+QD+HGLY S QGM Y G Sbjct: 164 LGRSSLGYGSSRSSMSSQDTHGLYGSRQGMGYGG 197 >gb|KHG08446.1| hypothetical protein F383_35471 [Gossypium arboreum] Length = 311 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG 535 LGRSN+GYG SR S+S+QDSHGLY+S QGM Y G Sbjct: 167 LGRSNLGYGGSRSSISSQDSHGLYASRQGMGYGG 200 >ref|XP_016544248.1| PREDICTED: uncharacterized protein LOC107844315 [Capsicum annuum] Length = 622 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 13/73 (17%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSGVAV-------------NLVACTHQAM 574 LGRSN+G G +R S+S QDSH +Y S QGM Y G + + V C+ AM Sbjct: 511 LGRSNLGCGGNRSSLSGQDSHRMYRSRQGMGYGGGGMFSSSYGSDYMSRGSDVECSRPAM 570 Query: 575 AVITYLVAVMLAE 613 VIT LVA ML + Sbjct: 571 EVITCLVAAMLTQ 583 >gb|KDO85461.1| hypothetical protein CISIN_1g0040411mg, partial [Citrus sinensis] gb|KDO85462.1| hypothetical protein CISIN_1g0040411mg, partial [Citrus sinensis] Length = 699 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG 535 +GRSN+GYG SR S+S+QDSHGLYSS QGM Y G Sbjct: 611 MGRSNLGYGGSRSSISSQDSHGLYSSRQGMGYGG 644 >gb|KDO85458.1| hypothetical protein CISIN_1g0040411mg, partial [Citrus sinensis] gb|KDO85459.1| hypothetical protein CISIN_1g0040411mg, partial [Citrus sinensis] gb|KDO85460.1| hypothetical protein CISIN_1g0040411mg, partial [Citrus sinensis] Length = 700 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG 535 +GRSN+GYG SR S+S+QDSHGLYSS QGM Y G Sbjct: 611 MGRSNLGYGGSRSSISSQDSHGLYSSRQGMGYGG 644 >gb|KDO85456.1| hypothetical protein CISIN_1g0040411mg, partial [Citrus sinensis] gb|KDO85457.1| hypothetical protein CISIN_1g0040411mg, partial [Citrus sinensis] Length = 701 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG 535 +GRSN+GYG SR S+S+QDSHGLYSS QGM Y G Sbjct: 611 MGRSNLGYGGSRSSISSQDSHGLYSSRQGMGYGG 644 >dbj|GAY57860.1| hypothetical protein CUMW_182710 [Citrus unshiu] Length = 775 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG 535 +GRSN+GYG SR S+S+QDSHGLYSS QGM Y G Sbjct: 687 MGRSNLGYGGSRSSISSQDSHGLYSSRQGMGYGG 720 >ref|NP_001275825.1| RNA recognition motif protein 1 [Citrus sinensis] ref|XP_006464400.1| PREDICTED: RNA recognition motif protein 1 isoform X4 [Citrus sinensis] ref|XP_024044264.1| heterogeneous nuclear ribonucleoprotein Q isoform X2 [Citrus clementina] gb|AEV43360.1| RNA recognition motif protein 1 [Citrus sinensis] gb|ESR58696.1| hypothetical protein CICLE_v10018944mg [Citrus clementina] Length = 775 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG 535 +GRSN+GYG SR S+S+QDSHGLYSS QGM Y G Sbjct: 687 MGRSNLGYGGSRSSISSQDSHGLYSSRQGMGYGG 720 >ref|XP_015387018.1| PREDICTED: RNA recognition motif protein 1 isoform X3 [Citrus sinensis] Length = 776 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG 535 +GRSN+GYG SR S+S+QDSHGLYSS QGM Y G Sbjct: 687 MGRSNLGYGGSRSSISSQDSHGLYSSRQGMGYGG 720 >ref|XP_006445454.1| heterogeneous nuclear ribonucleoprotein Q isoform X1 [Citrus clementina] ref|XP_006445455.1| heterogeneous nuclear ribonucleoprotein Q isoform X1 [Citrus clementina] ref|XP_006464397.1| PREDICTED: RNA recognition motif protein 1 isoform X2 [Citrus sinensis] ref|XP_024044263.1| heterogeneous nuclear ribonucleoprotein Q isoform X1 [Citrus clementina] gb|ESR58694.1| hypothetical protein CICLE_v10018944mg [Citrus clementina] gb|ESR58695.1| hypothetical protein CICLE_v10018944mg [Citrus clementina] dbj|GAY57861.1| hypothetical protein CUMW_182710 [Citrus unshiu] dbj|GAY57862.1| hypothetical protein CUMW_182720 [Citrus unshiu] Length = 776 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG 535 +GRSN+GYG SR S+S+QDSHGLYSS QGM Y G Sbjct: 687 MGRSNLGYGGSRSSISSQDSHGLYSSRQGMGYGG 720 >ref|XP_015386938.1| PREDICTED: RNA recognition motif protein 1 isoform X1 [Citrus sinensis] ref|XP_015386943.1| PREDICTED: RNA recognition motif protein 1 isoform X1 [Citrus sinensis] ref|XP_015386979.1| PREDICTED: RNA recognition motif protein 1 isoform X1 [Citrus sinensis] Length = 777 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG 535 +GRSN+GYG SR S+S+QDSHGLYSS QGM Y G Sbjct: 687 MGRSNLGYGGSRSSISSQDSHGLYSSRQGMGYGG 720 >gb|KJB38879.1| hypothetical protein B456_007G0851001, partial [Gossypium raimondii] Length = 552 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 434 LGRSNIGYGSSRGSMSAQDSHGLYSSHQGMAYSG 535 LGRSN+GYG SR S+S+QDSHGLY+S QGM Y G Sbjct: 461 LGRSNLGYGGSRSSISSQDSHGLYASRQGMGYGG 494