BLASTX nr result
ID: Chrysanthemum21_contig00017083
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00017083 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH88052.1| Peptidase C19, ubiquitin carboxyl-terminal hydrol... 98 6e-21 gb|KVI06756.1| Peptidase C19, ubiquitin carboxyl-terminal hydrol... 90 4e-18 ref|XP_022021178.1| ubiquitin carboxyl-terminal hydrolase 16-lik... 70 2e-11 ref|XP_022034891.1| ubiquitin carboxyl-terminal hydrolase 17-lik... 60 9e-08 >gb|KVH88052.1| Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 [Cynara cardunculus var. scolymus] Length = 1015 Score = 97.8 bits (242), Expect = 6e-21 Identities = 63/136 (46%), Positives = 76/136 (55%) Frame = -1 Query: 408 SKKPNNITDSSKHMSSDGVMSGKPPTCNSEMLNRRDGDVGGGLPPSKVREXXXXXXXXXX 229 S+K N+ ++SSK +DG S + T D VG LPPSK E Sbjct: 359 SRKSNDDSNSSKDKVNDGSKSRRSMTW--------DAGVGSDLPPSKFSESSHPPSGASS 410 Query: 228 XXXXXXAGYAKPKDDKAFGGLPSSGTERSNHVIINKSTTPHISKPREVVSSLSRASDTHL 49 GY+ KDDK GGLPSSG ERSN + NK+ T H SK RE+ SS SRASDT+L Sbjct: 411 HRASA--GYSTLKDDKTVGGLPSSGPERSNDLFSNKNVTSHTSKSRELGSSSSRASDTYL 468 Query: 48 TTLTNRHTSHSTKPVK 1 T T+RH S+S KPVK Sbjct: 469 -TFTSRHASYSIKPVK 483 >gb|KVI06756.1| Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 [Cynara cardunculus var. scolymus] Length = 1105 Score = 89.7 bits (221), Expect = 4e-18 Identities = 56/135 (41%), Positives = 69/135 (51%) Frame = -1 Query: 408 SKKPNNITDSSKHMSSDGVMSGKPPTCNSEMLNRRDGDVGGGLPPSKVREXXXXXXXXXX 229 SKK N SS + DG+ S + P EML D V LP S +E Sbjct: 399 SKKSNEEPTSSNELLMDGLKSTRQPKYTPEMLKHTDVVVDSDLPRSMFKEAKVSPSGAGS 458 Query: 228 XXXXXXAGYAKPKDDKAFGGLPSSGTERSNHVIINKSTTPHISKPREVVSSLSRASDTHL 49 ++ K KAFGG+PS+ ERSNHV NKS+ S+ V SSLS+ASDTHL Sbjct: 459 QYASGAGEHSTIKYSKAFGGMPSASLERSNHVFNNKSSISPASESIRVRSSLSKASDTHL 518 Query: 48 TTLTNRHTSHSTKPV 4 T+ T+R S S KPV Sbjct: 519 TSSTSRPVSQSPKPV 533 >ref|XP_022021178.1| ubiquitin carboxyl-terminal hydrolase 16-like [Helianthus annuus] gb|OTG34592.1| putative zinc finger, MYND-type, Ubiquitin specific protease domain protein [Helianthus annuus] Length = 1172 Score = 70.5 bits (171), Expect = 2e-11 Identities = 35/54 (64%), Positives = 43/54 (79%) Frame = -1 Query: 162 SSGTERSNHVIINKSTTPHISKPREVVSSLSRASDTHLTTLTNRHTSHSTKPVK 1 S +E+SN V NKSTTP SK R+VVSS RASDT+LTT+T+R+TSH TKP+K Sbjct: 551 SKVSEKSNDVFCNKSTTPDTSKSRDVVSSSPRASDTYLTTVTSRNTSHRTKPMK 604 >ref|XP_022034891.1| ubiquitin carboxyl-terminal hydrolase 17-like [Helianthus annuus] gb|OTG28451.1| putative ubiquitin-specific protease 17 [Helianthus annuus] Length = 844 Score = 60.1 bits (144), Expect = 9e-08 Identities = 36/64 (56%), Positives = 38/64 (59%) Frame = -1 Query: 192 KDDKAFGGLPSSGTERSNHVIINKSTTPHISKPREVVSSLSRASDTHLTTLTNRHTSHST 13 KDDK GGL SS +SN V N STTP ISK EVVSS T+RH SHST Sbjct: 215 KDDKTVGGLSSSKPGKSNDVFSNTSTTPDISKSGEVVSS-----------STSRHISHST 263 Query: 12 KPVK 1 KPVK Sbjct: 264 KPVK 267