BLASTX nr result
ID: Chrysanthemum21_contig00016976
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00016976 (619 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023745312.1| protein IQ-DOMAIN 14-like isoform X2 [Lactuc... 60 3e-07 ref|XP_023745310.1| protein IQ-DOMAIN 14-like isoform X1 [Lactuc... 60 3e-07 >ref|XP_023745312.1| protein IQ-DOMAIN 14-like isoform X2 [Lactuca sativa] gb|PLY65079.1| hypothetical protein LSAT_6X67641 [Lactuca sativa] Length = 463 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/44 (68%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -3 Query: 131 RFVHSQTQI-SRRPKPTLQQQHLSAIRIQAAYRGHMVRRNIKGL 3 R H QT+I S RP+PTLQQ+HLSA RIQAAYRG+M RR ++GL Sbjct: 114 RVAHQQTKIISDRPEPTLQQRHLSATRIQAAYRGYMERRKLRGL 157 >ref|XP_023745310.1| protein IQ-DOMAIN 14-like isoform X1 [Lactuca sativa] ref|XP_023745311.1| protein IQ-DOMAIN 14-like isoform X1 [Lactuca sativa] Length = 465 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/44 (68%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -3 Query: 131 RFVHSQTQI-SRRPKPTLQQQHLSAIRIQAAYRGHMVRRNIKGL 3 R H QT+I S RP+PTLQQ+HLSA RIQAAYRG+M RR ++GL Sbjct: 114 RVAHQQTKIISDRPEPTLQQRHLSATRIQAAYRGYMERRKLRGL 157