BLASTX nr result
ID: Chrysanthemum21_contig00016859
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00016859 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023731840.1| late embryogenesis abundant protein At5g1716... 57 1e-07 >ref|XP_023731840.1| late embryogenesis abundant protein At5g17165-like [Lactuca sativa] gb|PLY99698.1| hypothetical protein LSAT_0X9440 [Lactuca sativa] Length = 124 Score = 57.0 bits (136), Expect = 1e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = +2 Query: 44 ESAYEKGVEDKVNLEVNQVEKMTHKRGEYWEPDPDTGLFI 163 ESAYEK VED+V EV+ V ++T K EYWEPDP+TG+F+ Sbjct: 32 ESAYEKEVEDEVECEVSAVGEITDKPEEYWEPDPETGVFV 71