BLASTX nr result
ID: Chrysanthemum21_contig00016796
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00016796 (527 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI07248.1| Basic-leucine zipper domain-containing protein [C... 55 7e-06 >gb|KVI07248.1| Basic-leucine zipper domain-containing protein [Cynara cardunculus var. scolymus] Length = 301 Score = 55.5 bits (132), Expect = 7e-06 Identities = 48/97 (49%), Positives = 56/97 (57%), Gaps = 8/97 (8%) Frame = -1 Query: 269 SCKQEEPDFNDSMMTLEDFLAMSANEPQEQDVKXXXXXXPTDTLLSGSGRMLSFDNPSPD 90 SCKQE PD MMTLEDFLA A +E+DVK P++ L SG + SFDNP Sbjct: 114 SCKQEVPD---EMMTLEDFLA-KAGAVEEEDVKIPPPPLPSERL---SGGIFSFDNPIHP 166 Query: 89 LNVN--------VDNITARGGKRRPILADPLQDKAAQ 3 NV+ VD + R GKRR IL +PL DKAAQ Sbjct: 167 PNVDGVVGFGIGVDEMGGR-GKRRAIL-EPL-DKAAQ 200