BLASTX nr result
ID: Chrysanthemum21_contig00016694
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00016694 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY94170.1| hypothetical protein LSAT_5X17220 [Lactuca sativa] 84 3e-16 ref|XP_023752349.1| E3 ubiquitin-protein ligase SIS3-like [Lactu... 84 6e-16 ref|XP_021988557.1| E3 ubiquitin-protein ligase SIS3-like isofor... 81 2e-15 ref|XP_021988556.1| E3 ubiquitin-protein ligase SIS3-like isofor... 81 4e-15 ref|XP_020269448.1| E3 ubiquitin-protein ligase SIS3 [Asparagus ... 78 7e-14 ref|XP_023765020.1| E3 ubiquitin-protein ligase SIS3-like isofor... 77 8e-14 ref|XP_023765019.1| E3 ubiquitin-protein ligase SIS3-like isofor... 77 1e-13 ref|XP_023765018.1| E3 ubiquitin-protein ligase SIS3-like isofor... 77 1e-13 ref|XP_022034032.1| E3 ubiquitin-protein ligase SIS3-like isofor... 77 1e-13 ref|XP_022034031.1| E3 ubiquitin-protein ligase SIS3-like isofor... 77 1e-13 gb|OTG27574.1| putative zinc finger, RING/FYVE/PHD-type [Heliant... 77 2e-13 gb|OVA07594.1| zinc finger protein [Macleaya cordata] 76 2e-13 gb|ONM41553.1| E3 ubiquitin-protein ligase SIS3 [Zea mays] >gi|1... 74 2e-13 ref|XP_019068598.1| PREDICTED: E3 ubiquitin-protein ligase SIS3 ... 75 3e-13 ref|XP_015067449.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-... 75 3e-13 ref|XP_015067447.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-... 75 4e-13 ref|XP_023752351.1| E3 ubiquitin-protein ligase SIS3-like isofor... 75 4e-13 gb|ONM41555.1| E3 ubiquitin-protein ligase SIS3 [Zea mays] 74 4e-13 gb|PNY09440.1| E3 ubiquitin-protein ligase sis3-like protein, pa... 75 4e-13 ref|XP_022015669.1| E3 ubiquitin-protein ligase SIS3 isoform X2 ... 75 4e-13 >gb|PLY94170.1| hypothetical protein LSAT_5X17220 [Lactuca sativa] Length = 312 Score = 83.6 bits (205), Expect = 3e-16 Identities = 36/52 (69%), Positives = 41/52 (78%) Frame = -3 Query: 250 QHQRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 + QR A++T IQRLP++ILK VPTDC DCPIC EEF V Q VRG PCAHN H Sbjct: 150 ESQRTAVETSIQRLPVFILKAVPTDCSDCPICLEEFHVGQGVRGLPCAHNFH 201 >ref|XP_023752349.1| E3 ubiquitin-protein ligase SIS3-like [Lactuca sativa] Length = 369 Score = 83.6 bits (205), Expect = 6e-16 Identities = 36/52 (69%), Positives = 41/52 (78%) Frame = -3 Query: 250 QHQRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 + QR A++T IQRLP++ILK VPTDC DCPIC EEF V Q VRG PCAHN H Sbjct: 207 ESQRTAVETSIQRLPVFILKAVPTDCSDCPICLEEFHVGQGVRGLPCAHNFH 258 >ref|XP_021988557.1| E3 ubiquitin-protein ligase SIS3-like isoform X2 [Helianthus annuus] Length = 309 Score = 81.3 bits (199), Expect = 2e-15 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = -3 Query: 244 QRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 QRAA++T IQ+LP+YILK +P DC DCPIC EEF V Q VRG PCAHN H Sbjct: 149 QRAAVETAIQQLPVYILKGIPPDCSDCPICLEEFVVGQGVRGLPCAHNFH 198 >ref|XP_021988556.1| E3 ubiquitin-protein ligase SIS3-like isoform X1 [Helianthus annuus] gb|OTG11166.1| putative zinc finger, RING/FYVE/PHD-type [Helianthus annuus] Length = 369 Score = 81.3 bits (199), Expect = 4e-15 Identities = 35/50 (70%), Positives = 40/50 (80%) Frame = -3 Query: 244 QRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 QRAA++T IQ+LP+YILK +P DC DCPIC EEF V Q VRG PCAHN H Sbjct: 209 QRAAVETAIQQLPVYILKGIPPDCSDCPICLEEFVVGQGVRGLPCAHNFH 258 >ref|XP_020269448.1| E3 ubiquitin-protein ligase SIS3 [Asparagus officinalis] gb|ONK66288.1| uncharacterized protein A4U43_C06F6150 [Asparagus officinalis] Length = 375 Score = 77.8 bits (190), Expect = 7e-14 Identities = 33/50 (66%), Positives = 37/50 (74%) Frame = -3 Query: 244 QRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 QR A++ IQ LP + LK VPTDC +CPIC EEFCV EVRG PCAHN H Sbjct: 208 QRDAVEALIQELPKFRLKAVPTDCSECPICLEEFCVGNEVRGLPCAHNFH 257 >ref|XP_023765020.1| E3 ubiquitin-protein ligase SIS3-like isoform X3 [Lactuca sativa] Length = 341 Score = 77.4 bits (189), Expect = 8e-14 Identities = 34/50 (68%), Positives = 37/50 (74%) Frame = -3 Query: 244 QRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 QR A++ IQ LPL+ LK VPTDC DCPIC EEF V EVRG PCAHN H Sbjct: 152 QRQAVEILIQELPLFSLKAVPTDCSDCPICLEEFHVGDEVRGLPCAHNFH 201 >ref|XP_023765019.1| E3 ubiquitin-protein ligase SIS3-like isoform X2 [Lactuca sativa] Length = 377 Score = 77.4 bits (189), Expect = 1e-13 Identities = 34/50 (68%), Positives = 37/50 (74%) Frame = -3 Query: 244 QRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 QR A++ IQ LPL+ LK VPTDC DCPIC EEF V EVRG PCAHN H Sbjct: 188 QRQAVEILIQELPLFSLKAVPTDCSDCPICLEEFHVGDEVRGLPCAHNFH 237 >ref|XP_023765018.1| E3 ubiquitin-protein ligase SIS3-like isoform X1 [Lactuca sativa] gb|PLY84615.1| hypothetical protein LSAT_1X26880 [Lactuca sativa] Length = 401 Score = 77.4 bits (189), Expect = 1e-13 Identities = 34/50 (68%), Positives = 37/50 (74%) Frame = -3 Query: 244 QRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 QR A++ IQ LPL+ LK VPTDC DCPIC EEF V EVRG PCAHN H Sbjct: 212 QRQAVEILIQELPLFSLKAVPTDCSDCPICLEEFHVGDEVRGLPCAHNFH 261 >ref|XP_022034032.1| E3 ubiquitin-protein ligase SIS3-like isoform X2 [Helianthus annuus] Length = 384 Score = 77.0 bits (188), Expect = 1e-13 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -3 Query: 250 QHQRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 ++QR A++ I LPL+ LK VPTDC DCPIC EEF V EVRG PCAHN H Sbjct: 209 ENQRQAVEALIHELPLFSLKAVPTDCSDCPICLEEFHVGDEVRGLPCAHNFH 260 >ref|XP_022034031.1| E3 ubiquitin-protein ligase SIS3-like isoform X1 [Helianthus annuus] Length = 385 Score = 77.0 bits (188), Expect = 1e-13 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -3 Query: 250 QHQRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 ++QR A++ I LPL+ LK VPTDC DCPIC EEF V EVRG PCAHN H Sbjct: 210 ENQRQAVEALIHELPLFSLKAVPTDCSDCPICLEEFHVGDEVRGLPCAHNFH 261 >gb|OTG27574.1| putative zinc finger, RING/FYVE/PHD-type [Helianthus annuus] Length = 472 Score = 77.0 bits (188), Expect = 2e-13 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -3 Query: 250 QHQRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 ++QR A++ I LPL+ LK VPTDC DCPIC EEF V EVRG PCAHN H Sbjct: 297 ENQRQAVEALIHELPLFSLKAVPTDCSDCPICLEEFHVGDEVRGLPCAHNFH 348 >gb|OVA07594.1| zinc finger protein [Macleaya cordata] Length = 331 Score = 76.3 bits (186), Expect = 2e-13 Identities = 32/50 (64%), Positives = 36/50 (72%) Frame = -3 Query: 244 QRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 QR A++ IQ LP + LK VP DC +CPIC EEFCV EVRG PCAHN H Sbjct: 153 QREAVEALIQELPKFRLKAVPVDCSECPICLEEFCVGNEVRGLPCAHNFH 202 >gb|ONM41553.1| E3 ubiquitin-protein ligase SIS3 [Zea mays] gb|ONM41554.1| E3 ubiquitin-protein ligase SIS3 [Zea mays] gb|ONM41557.1| E3 ubiquitin-protein ligase SIS3 [Zea mays] gb|ONM41559.1| E3 ubiquitin-protein ligase SIS3 [Zea mays] gb|ONM41565.1| E3 ubiquitin-protein ligase SIS3 [Zea mays] Length = 201 Score = 74.3 bits (181), Expect = 2e-13 Identities = 39/75 (52%), Positives = 45/75 (60%) Frame = -3 Query: 319 EAVNLNLFQPRLINQHPSDV*TWQHQRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFC 140 EAV L + + HP T QR A++ IQ LP + LK VPTDC +CPIC EEF Sbjct: 10 EAVGLEMRVGQDTAYHPGLYLT-DAQREAVEALIQELPKFRLKAVPTDCSECPICLEEFH 68 Query: 139 VRQEVRGFPCAHNLH 95 V EVRG PCAHN H Sbjct: 69 VGNEVRGLPCAHNFH 83 >ref|XP_019068598.1| PREDICTED: E3 ubiquitin-protein ligase SIS3 isoform X2 [Solanum lycopersicum] Length = 320 Score = 75.5 bits (184), Expect = 3e-13 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = -3 Query: 250 QHQRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 Q QR A++ IQ LP++ +K VPTDC +CPIC EEF V EVRG PCAHN H Sbjct: 150 QAQREAVEALIQELPMFRMKAVPTDCSECPICLEEFDVGNEVRGLPCAHNFH 201 >ref|XP_015067449.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-like isoform X3 [Solanum pennellii] Length = 320 Score = 75.5 bits (184), Expect = 3e-13 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = -3 Query: 250 QHQRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 Q QR A++ IQ LP++ +K VPTDC +CPIC EEF V EVRG PCAHN H Sbjct: 150 QAQREAVEALIQELPMFRMKAVPTDCSECPICLEEFDVGNEVRGLPCAHNFH 201 >ref|XP_015067447.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-like isoform X2 [Solanum pennellii] ref|XP_015067448.1| PREDICTED: E3 ubiquitin-protein ligase SIS3-like isoform X2 [Solanum pennellii] Length = 330 Score = 75.5 bits (184), Expect = 4e-13 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = -3 Query: 250 QHQRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 Q QR A++ IQ LP++ +K VPTDC +CPIC EEF V EVRG PCAHN H Sbjct: 160 QAQREAVEALIQELPMFRMKAVPTDCSECPICLEEFDVGNEVRGLPCAHNFH 211 >ref|XP_023752351.1| E3 ubiquitin-protein ligase SIS3-like isoform X2 [Lactuca sativa] Length = 301 Score = 75.1 bits (183), Expect = 4e-13 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = -3 Query: 244 QRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 QR A++ IQ LP ++LK VPTDC +CPIC EEF V EVRG PCAHN H Sbjct: 153 QREAVEALIQELPKFMLKAVPTDCSECPICLEEFHVGNEVRGLPCAHNFH 202 >gb|ONM41555.1| E3 ubiquitin-protein ligase SIS3 [Zea mays] Length = 247 Score = 74.3 bits (181), Expect = 4e-13 Identities = 39/75 (52%), Positives = 45/75 (60%) Frame = -3 Query: 319 EAVNLNLFQPRLINQHPSDV*TWQHQRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFC 140 EAV L + + HP T QR A++ IQ LP + LK VPTDC +CPIC EEF Sbjct: 56 EAVGLEMRVGQDTAYHPGLYLT-DAQREAVEALIQELPKFRLKAVPTDCSECPICLEEFH 114 Query: 139 VRQEVRGFPCAHNLH 95 V EVRG PCAHN H Sbjct: 115 VGNEVRGLPCAHNFH 129 >gb|PNY09440.1| E3 ubiquitin-protein ligase sis3-like protein, partial [Trifolium pratense] Length = 305 Score = 75.1 bits (183), Expect = 4e-13 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = -3 Query: 244 QRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 QR A++ IQ LP ++LK VPTDC +CPIC EEF V EVRG PCAHN H Sbjct: 134 QREAVEALIQELPKFMLKAVPTDCSECPICLEEFRVGNEVRGLPCAHNFH 183 >ref|XP_022015669.1| E3 ubiquitin-protein ligase SIS3 isoform X2 [Helianthus annuus] Length = 305 Score = 75.1 bits (183), Expect = 4e-13 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = -3 Query: 244 QRAAIDTKIQRLPLYILKVVPTDCRDCPICSEEFCVRQEVRGFPCAHNLH 95 QR A++ IQ LP ++LK VPTDC +CPIC EEF V EVRG PCAHN H Sbjct: 152 QREAVEALIQELPKFMLKAVPTDCSECPICLEEFHVGNEVRGLPCAHNFH 201