BLASTX nr result
ID: Chrysanthemum21_contig00016669
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00016669 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMO81526.1| Actin-related protein [Corchorus olitorius] 57 8e-07 gb|KVH88936.1| Actin-related protein [Cynara cardunculus var. sc... 57 8e-07 gb|KVH95686.1| Actin-related protein [Cynara cardunculus var. sc... 57 8e-07 gb|PIN26389.1| Actin-related protein Arp2/3 complex, subunit Arp... 57 8e-07 ref|XP_011071166.1| actin-related protein 3 [Sesamum indicum] 57 8e-07 ref|XP_012845533.1| PREDICTED: actin-related protein 3 [Erythran... 57 8e-07 ref|XP_023745279.1| actin-related protein 3 [Lactuca sativa] >gi... 57 8e-07 gb|OMO60334.1| Actin-related protein [Corchorus capsularis] 57 8e-07 gb|PPS17247.1| hypothetical protein GOBAR_AA03338 [Gossypium bar... 53 1e-06 ref|XP_020551829.1| actin-related protein 3-like [Sesamum indicum] 56 1e-06 emb|CBI16833.3| unnamed protein product, partial [Vitis vinifera] 55 2e-06 ref|XP_017421267.1| PREDICTED: actin-related protein 3-like [Vig... 55 2e-06 ref|XP_002285370.1| PREDICTED: actin-related protein 3 isoform X... 55 2e-06 ref|XP_019280277.1| PREDICTED: actin-related protein 3B-like [Pa... 53 2e-06 gb|KQL30319.1| hypothetical protein SETIT_0172481mg, partial [Se... 53 3e-06 ref|XP_014508036.1| actin-related protein 3 [Vigna radiata var. ... 55 3e-06 ref|XP_007159622.1| hypothetical protein PHAVU_002G252900g [Phas... 55 3e-06 ref|XP_003525030.1| PREDICTED: actin-related protein 3 [Glycine ... 55 3e-06 ref|XP_020215867.1| actin-related protein 3-like [Cajanus cajan]... 55 3e-06 ref|XP_022025936.1| actin-related protein 3 [Helianthus annuus] ... 55 3e-06 >gb|OMO81526.1| Actin-related protein [Corchorus olitorius] Length = 407 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +2 Query: 218 PVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 PVE+NV S IQRY V FGGSVLASTPEFFTAC Sbjct: 351 PVEVNVVSHPIQRYAVWFGGSVLASTPEFFTAC 383 >gb|KVH88936.1| Actin-related protein [Cynara cardunculus var. scolymus] Length = 418 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +2 Query: 218 PVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 PVE+NV S IQRY V FGGSVLASTPEFFTAC Sbjct: 362 PVEVNVVSHPIQRYAVWFGGSVLASTPEFFTAC 394 >gb|KVH95686.1| Actin-related protein [Cynara cardunculus var. scolymus] Length = 428 Score = 56.6 bits (135), Expect = 8e-07 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = +2 Query: 176 SYLQKHRDPKPQELPVELNVASLQIQRYVVCFGGSVLASTPEFFTACQ 319 SY + +R+ K PVE+NV S IQ Y V FGGSVLASTPEF+TAC+ Sbjct: 360 SYARSNREVKAH--PVEVNVVSHPIQSYAVWFGGSVLASTPEFYTACR 405 >gb|PIN26389.1| Actin-related protein Arp2/3 complex, subunit Arp3 [Handroanthus impetiginosus] Length = 430 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +2 Query: 218 PVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 PVE+NV S IQRY V FGGSVLASTPEFFTAC Sbjct: 374 PVEVNVVSHPIQRYAVWFGGSVLASTPEFFTAC 406 >ref|XP_011071166.1| actin-related protein 3 [Sesamum indicum] Length = 430 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +2 Query: 218 PVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 PVE+NV S IQRY V FGGSVLASTPEFFTAC Sbjct: 374 PVEVNVVSHPIQRYAVWFGGSVLASTPEFFTAC 406 >ref|XP_012845533.1| PREDICTED: actin-related protein 3 [Erythranthe guttata] gb|EYU30597.1| hypothetical protein MIMGU_mgv1a006817mg [Erythranthe guttata] Length = 430 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +2 Query: 218 PVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 PVE+NV S IQRY V FGGSVLASTPEFFTAC Sbjct: 374 PVEVNVVSHPIQRYAVWFGGSVLASTPEFFTAC 406 >ref|XP_023745279.1| actin-related protein 3 [Lactuca sativa] gb|PLY65110.1| hypothetical protein LSAT_4X2801 [Lactuca sativa] Length = 431 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +2 Query: 218 PVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 PVE+NV S IQRY V FGGSVLASTPEFFTAC Sbjct: 375 PVEVNVVSHPIQRYAVWFGGSVLASTPEFFTAC 407 >gb|OMO60334.1| Actin-related protein [Corchorus capsularis] Length = 463 Score = 56.6 bits (135), Expect = 8e-07 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = +2 Query: 218 PVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 PVE+NV S IQRY V FGGSVLASTPEFFTAC Sbjct: 371 PVEVNVVSHPIQRYAVWFGGSVLASTPEFFTAC 403 >gb|PPS17247.1| hypothetical protein GOBAR_AA03338 [Gossypium barbadense] Length = 92 Score = 53.1 bits (126), Expect = 1e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 218 PVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 PVE+NV S IQR+ V FGGSVLASTPEFF AC Sbjct: 36 PVEVNVVSHPIQRFAVWFGGSVLASTPEFFAAC 68 >ref|XP_020551829.1| actin-related protein 3-like [Sesamum indicum] Length = 430 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 218 PVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 PVE+NV S +QRY V FGGSVLASTPEFFTAC Sbjct: 374 PVEVNVLSHPVQRYAVWFGGSVLASTPEFFTAC 406 >emb|CBI16833.3| unnamed protein product, partial [Vitis vinifera] Length = 382 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +2 Query: 197 DPKPQELPVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 D + + PVE+NV S IQRY V FGGSVLASTPEFF AC Sbjct: 319 DGEVKSQPVEVNVVSHPIQRYAVWFGGSVLASTPEFFAAC 358 >ref|XP_017421267.1| PREDICTED: actin-related protein 3-like [Vigna angularis] ref|XP_017421275.1| PREDICTED: actin-related protein 3-like [Vigna angularis] Length = 427 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 218 PVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 PVE+NV S IQR+ V FGGSVLASTPEFFTAC Sbjct: 371 PVEINVVSHPIQRFAVWFGGSVLASTPEFFTAC 403 >ref|XP_002285370.1| PREDICTED: actin-related protein 3 isoform X1 [Vitis vinifera] Length = 428 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +2 Query: 197 DPKPQELPVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 D + + PVE+NV S IQRY V FGGSVLASTPEFF AC Sbjct: 365 DGEVKSQPVEVNVVSHPIQRYAVWFGGSVLASTPEFFAAC 404 >ref|XP_019280277.1| PREDICTED: actin-related protein 3B-like [Panthera pardus] Length = 113 Score = 52.8 bits (125), Expect = 2e-06 Identities = 34/73 (46%), Positives = 41/73 (56%) Frame = +2 Query: 98 RERLNSRRLYSKGVRHKYNWRPNNKHSYLQKHRDPKPQELPVELNVASLQIQRYVVCFGG 277 R L+S L V + WR N +S LQ PKP VE+ V + +QRY V FGG Sbjct: 25 RAELSSCLLSGCWVTSRPPWRLNVPYSLLQ----PKP----VEVQVITHHMQRYAVWFGG 76 Query: 278 SVLASTPEFFTAC 316 S+LASTPEFF C Sbjct: 77 SMLASTPEFFQVC 89 >gb|KQL30319.1| hypothetical protein SETIT_0172481mg, partial [Setaria italica] Length = 139 Score = 53.1 bits (126), Expect = 3e-06 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +2 Query: 197 DPKPQELPVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 DPK Q P+E+NV S IQRY V FGGSVLAST EF+ AC Sbjct: 78 DPKAQ--PIEVNVVSHPIQRYAVWFGGSVLASTAEFYEAC 115 >ref|XP_014508036.1| actin-related protein 3 [Vigna radiata var. radiata] ref|XP_014508037.1| actin-related protein 3 [Vigna radiata var. radiata] Length = 427 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 218 PVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 PVE+NV S IQR+ V FGGSVLASTPEFFTAC Sbjct: 371 PVEVNVVSHPIQRFAVWFGGSVLASTPEFFTAC 403 >ref|XP_007159622.1| hypothetical protein PHAVU_002G252900g [Phaseolus vulgaris] gb|ESW31616.1| hypothetical protein PHAVU_002G252900g [Phaseolus vulgaris] Length = 428 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 218 PVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 PVE+NV S IQR+ V FGGSVLASTPEFFTAC Sbjct: 372 PVEVNVVSHPIQRFAVWFGGSVLASTPEFFTAC 404 >ref|XP_003525030.1| PREDICTED: actin-related protein 3 [Glycine max] gb|KHN06529.1| Actin-related protein 3 [Glycine soja] gb|KRH59228.1| hypothetical protein GLYMA_05G172600 [Glycine max] Length = 428 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 218 PVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 PVE+NV S IQRY V FGGSVLASTP+FFTAC Sbjct: 372 PVEVNVLSNPIQRYAVWFGGSVLASTPDFFTAC 404 >ref|XP_020215867.1| actin-related protein 3-like [Cajanus cajan] gb|KYP67590.1| Actin-related protein 3 [Cajanus cajan] Length = 429 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 218 PVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 PVE+NV S IQR+ V FGGSVLASTPEFFTAC Sbjct: 373 PVEVNVVSHPIQRFAVWFGGSVLASTPEFFTAC 405 >ref|XP_022025936.1| actin-related protein 3 [Helianthus annuus] gb|OTF88129.1| putative actin-like ATPase superfamily protein [Helianthus annuus] Length = 431 Score = 55.1 bits (131), Expect = 3e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +2 Query: 218 PVELNVASLQIQRYVVCFGGSVLASTPEFFTAC 316 PVE+NV S IQRY FGGSVLASTPEFFTAC Sbjct: 375 PVEVNVVSHPIQRYAAWFGGSVLASTPEFFTAC 407