BLASTX nr result
ID: Chrysanthemum21_contig00016557
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00016557 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX87141.1| auxin-induced in root cultures protein 12-like, p... 53 8e-06 >gb|PNX87141.1| auxin-induced in root cultures protein 12-like, partial [Trifolium pratense] Length = 201 Score = 53.1 bits (126), Expect = 8e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 287 III*QTHGVLNAVSWGVLMPLGAMTARYLK 376 +I QTHG+LNAVSWGVLMPLGA+ ARYLK Sbjct: 2 LICFQTHGILNAVSWGVLMPLGAVIARYLK 31