BLASTX nr result
ID: Chrysanthemum21_contig00016547
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00016547 (688 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI00364.1| Peptidyl-prolyl cis-trans isomerase, FKBP-type [C... 51 3e-08 gb|KJB37902.1| hypothetical protein B456_006G225400 [Gossypium r... 42 1e-05 >gb|KVI00364.1| Peptidyl-prolyl cis-trans isomerase, FKBP-type [Cynara cardunculus var. scolymus] Length = 564 Score = 50.8 bits (120), Expect(2) = 3e-08 Identities = 26/42 (61%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +1 Query: 313 KEKYLRELTTPERIKTCGR*TER-NTIFKKQKYERISKRYER 435 KEK EL+TPE+I+T GR E NT+FK++KYER SKRYE+ Sbjct: 374 KEKDSWELSTPEKIETSGRKKEEGNTLFKRKKYERASKRYEK 415 Score = 35.4 bits (80), Expect(2) = 3e-08 Identities = 14/25 (56%), Positives = 22/25 (88%) Frame = +2 Query: 245 YQESGIIPASSTVYYDVEFVSFKRK 319 +QES IPA+STV+Y+VE +SF+++ Sbjct: 351 HQESATIPANSTVHYNVELISFEKE 375 >gb|KJB37902.1| hypothetical protein B456_006G225400 [Gossypium raimondii] Length = 451 Score = 42.0 bits (97), Expect(2) = 1e-05 Identities = 21/44 (47%), Positives = 30/44 (68%), Gaps = 1/44 (2%) Frame = +1 Query: 313 KEKYLRELTTPERIKTCGR*TER-NTIFKKQKYERISKRYERVN 441 KEK E+ TP++I+ G+ E N +FK K+ER SKRYE+V+ Sbjct: 385 KEKESWEMDTPQKIEAAGKKKEEGNALFKAGKFERASKRYEKVS 428 Score = 35.8 bits (81), Expect(2) = 1e-05 Identities = 14/25 (56%), Positives = 21/25 (84%) Frame = +2 Query: 245 YQESGIIPASSTVYYDVEFVSFKRK 319 +QE ++PA+STVYY+VE VSF ++ Sbjct: 362 HQELAVVPANSTVYYEVEMVSFVKE 386