BLASTX nr result
ID: Chrysanthemum21_contig00016330
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00016330 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH99547.1| hypothetical protein Ccrd_022217 [Cynara carduncu... 60 6e-08 ref|XP_022039744.1| random slug protein 5-like isoform X1 [Helia... 59 1e-07 gb|PLY66581.1| hypothetical protein LSAT_6X102241 [Lactuca sativa] 55 2e-06 >gb|KVH99547.1| hypothetical protein Ccrd_022217 [Cynara cardunculus var. scolymus] Length = 378 Score = 59.7 bits (143), Expect = 6e-08 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = +2 Query: 212 NPRSKRDY*QAMNPQLKKSNSNGPLAPEDQQKTIVEVREAIKKLKSLE 355 +P K+D QAMNPQL K NSN L PED+QK I EVRE IKK KS++ Sbjct: 50 SPERKKDLFQAMNPQLNKPNSNLLLTPEDEQKMITEVRETIKKHKSIK 97 >ref|XP_022039744.1| random slug protein 5-like isoform X1 [Helianthus annuus] ref|XP_022039745.1| random slug protein 5-like isoform X1 [Helianthus annuus] Length = 323 Score = 58.5 bits (140), Expect = 1e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +2 Query: 245 MNPQLKKSNSNGPLAPEDQQKTIVEVREAIKKLKSLE 355 MNPQ K NSNGPL PEDQQK I+EVREAI K KS+E Sbjct: 1 MNPQPSKLNSNGPLTPEDQQKLIIEVREAINKHKSIE 37 >gb|PLY66581.1| hypothetical protein LSAT_6X102241 [Lactuca sativa] Length = 337 Score = 55.1 bits (131), Expect = 2e-06 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = +2 Query: 218 RSKRDY*QAMNPQLKKSNSNGPLAPEDQQKTIVEVREAIKKLKSLE 355 RS R +AMN Q KKSNSN L PED+QK I+EVR+ IKK KSLE Sbjct: 34 RSTRISNRAMNLQPKKSNSNVALTPEDEQKMIIEVRDTIKKQKSLE 79