BLASTX nr result
ID: Chrysanthemum21_contig00015986
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00015986 (421 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021976767.1| probable WRKY transcription factor 70 [Helia... 56 2e-06 >ref|XP_021976767.1| probable WRKY transcription factor 70 [Helianthus annuus] gb|OTG17858.1| putative WRKY DNA-binding protein 54 [Helianthus annuus] Length = 307 Score = 56.2 bits (134), Expect = 2e-06 Identities = 34/88 (38%), Positives = 48/88 (54%) Frame = +3 Query: 156 DLLTEASESFASGLSMLSTSRSEVHQESEVFKRNSEKTPTQGQSFSPNANLTPLVLVKQG 335 DLL E ESF+ GLSML+ + S E+ + + T Q P+V ++G Sbjct: 44 DLLAEILESFSGGLSMLNYTDS-----GEISRVPASPTVFQVPDVCTGKKPAPVVKERRG 98 Query: 336 RERKSRDRDTRVEISNTIEDCYQWRKYG 419 ++ R D+RV+IS T+ED Y WRKYG Sbjct: 99 CYKRRRTVDSRVKISTTMEDGYAWRKYG 126