BLASTX nr result
ID: Chrysanthemum21_contig00015931
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00015931 (541 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021988741.1| uncharacterized protein LOC110885368 [Helian... 56 6e-06 >ref|XP_021988741.1| uncharacterized protein LOC110885368 [Helianthus annuus] gb|OTG11385.1| putative T-complex protein 11 [Helianthus annuus] Length = 1143 Score = 56.2 bits (134), Expect = 6e-06 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = -3 Query: 293 GLLKA*IGKTCARLLQLRKVAEFVFHQTEIGRARVTQTLEEKLQRANRHRS 141 GLL+A + K ARLLQ+RKVA+FV Q EI R R+ ++LE+KLQRA R R+ Sbjct: 210 GLLEADMEKAHARLLQVRKVAKFVSQQREIERRRLRESLEDKLQRAKRQRA 260