BLASTX nr result
ID: Chrysanthemum21_contig00015599
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00015599 (385 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023772072.1| WPP domain-associated protein [Lactuca sativa] 69 6e-11 gb|OTF97043.1| putative WPP domain-associated protein [Helianthu... 67 2e-10 gb|KVI07765.1| hypothetical protein Ccrd_013869 [Cynara carduncu... 67 2e-10 ref|XP_022008760.1| WPP domain-associated protein [Helianthus an... 66 5e-10 ref|XP_021657792.1| WPP domain-associated protein-like [Hevea br... 65 9e-10 ref|XP_021634744.1| WPP domain-associated protein-like [Manihot ... 65 9e-10 ref|XP_021615746.1| WPP domain-associated protein [Manihot escul... 65 9e-10 ref|XP_002523187.1| PREDICTED: WPP domain-associated protein [Ri... 65 1e-09 ref|XP_012075755.1| WPP domain-associated protein [Jatropha curcas] 64 3e-09 ref|XP_012075616.1| WPP domain-associated protein [Jatropha curcas] 64 3e-09 gb|KZV58278.1| WPP domain-associated protein [Dorcoceras hygrome... 64 3e-09 ref|XP_010056982.1| PREDICTED: WPP domain-associated protein iso... 64 4e-09 ref|XP_019420011.1| PREDICTED: WPP domain-associated protein-lik... 63 6e-09 ref|XP_021722574.1| LOW QUALITY PROTEIN: WPP domain-associated p... 63 8e-09 ref|XP_021764149.1| WPP domain-associated protein-like [Chenopod... 63 8e-09 ref|XP_013463012.1| WPP domain associated protein [Medicago trun... 63 8e-09 ref|XP_012569941.1| PREDICTED: WPP domain-associated protein iso... 62 1e-08 ref|XP_004486461.1| PREDICTED: WPP domain-associated protein iso... 62 1e-08 gb|PIN01082.1| hypothetical protein CDL12_26417 [Handroanthus im... 62 1e-08 ref|XP_010316952.1| PREDICTED: WPP domain-associated protein [So... 62 1e-08 >ref|XP_023772072.1| WPP domain-associated protein [Lactuca sativa] Length = 834 Score = 68.9 bits (167), Expect = 6e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLKAH 280 IALDHYSPVLQHY GV+EILELVRRELSGESLKAH Sbjct: 800 IALDHYSPVLQHYSGVIEILELVRRELSGESLKAH 834 >gb|OTF97043.1| putative WPP domain-associated protein [Helianthus annuus] Length = 787 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLKAH*SH 271 IALDHYSPVL+HYPGV+EILELVRRELSGE++ AH H Sbjct: 747 IALDHYSPVLKHYPGVIEILELVRRELSGEAVNAHRHH 784 >gb|KVI07765.1| hypothetical protein Ccrd_013869 [Cynara cardunculus var. scolymus] Length = 873 Score = 67.4 bits (163), Expect = 2e-10 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLKA 283 IALDHYSPVLQHYPGV+EIL+LVRRELSGESLKA Sbjct: 839 IALDHYSPVLQHYPGVIEILKLVRRELSGESLKA 872 >ref|XP_022008760.1| WPP domain-associated protein [Helianthus annuus] Length = 794 Score = 66.2 bits (160), Expect = 5e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLKAH 280 IALDHYSPVL+HYPGV+EILELVRRELSGE++ AH Sbjct: 757 IALDHYSPVLKHYPGVIEILELVRRELSGEAVNAH 791 >ref|XP_021657792.1| WPP domain-associated protein-like [Hevea brasiliensis] ref|XP_021657794.1| WPP domain-associated protein-like [Hevea brasiliensis] Length = 840 Score = 65.5 bits (158), Expect = 9e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLK 286 IALDHYSP+LQHYPG+MEIL+LVRRELSGES+K Sbjct: 806 IALDHYSPILQHYPGIMEILKLVRRELSGESVK 838 >ref|XP_021634744.1| WPP domain-associated protein-like [Manihot esculenta] gb|OAY31575.1| hypothetical protein MANES_14G123600 [Manihot esculenta] Length = 862 Score = 65.5 bits (158), Expect = 9e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLK 286 IALDHYSP+LQHYPG+MEIL+LVRRELSGES+K Sbjct: 828 IALDHYSPILQHYPGIMEILKLVRRELSGESVK 860 >ref|XP_021615746.1| WPP domain-associated protein [Manihot esculenta] ref|XP_021615747.1| WPP domain-associated protein [Manihot esculenta] ref|XP_021615748.1| WPP domain-associated protein [Manihot esculenta] gb|OAY47299.1| hypothetical protein MANES_06G068100 [Manihot esculenta] gb|OAY47300.1| hypothetical protein MANES_06G068100 [Manihot esculenta] gb|OAY47301.1| hypothetical protein MANES_06G068100 [Manihot esculenta] Length = 877 Score = 65.5 bits (158), Expect = 9e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLK 286 IALDHYSP+LQHYPG+MEIL+LVRRELSGES+K Sbjct: 843 IALDHYSPILQHYPGIMEILKLVRRELSGESVK 875 >ref|XP_002523187.1| PREDICTED: WPP domain-associated protein [Ricinus communis] ref|XP_015577267.1| PREDICTED: WPP domain-associated protein [Ricinus communis] gb|EEF39218.1| Early endosome antigen, putative [Ricinus communis] Length = 903 Score = 65.1 bits (157), Expect = 1e-09 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLK 286 IALDHYSP+LQHYPG+ME+L+LVRRELSGES+K Sbjct: 869 IALDHYSPILQHYPGIMEVLKLVRRELSGESVK 901 >ref|XP_012075755.1| WPP domain-associated protein [Jatropha curcas] Length = 819 Score = 63.9 bits (154), Expect = 3e-09 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLK 286 IALDHYSP+L+HYPG+MEIL+LVRRELSGES+K Sbjct: 785 IALDHYSPILKHYPGIMEILKLVRRELSGESVK 817 >ref|XP_012075616.1| WPP domain-associated protein [Jatropha curcas] Length = 883 Score = 63.9 bits (154), Expect = 3e-09 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLK 286 IALDHYSP+L+HYPG+MEIL+LVRRELSGES+K Sbjct: 849 IALDHYSPILKHYPGIMEILKLVRRELSGESVK 881 >gb|KZV58278.1| WPP domain-associated protein [Dorcoceras hygrometricum] Length = 915 Score = 63.9 bits (154), Expect = 3e-09 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLK 286 IALDHYSP+L+HYPG++EILELVRRELSGES+K Sbjct: 881 IALDHYSPILKHYPGIIEILELVRRELSGESVK 913 >ref|XP_010056982.1| PREDICTED: WPP domain-associated protein isoform X1 [Eucalyptus grandis] ref|XP_010056983.1| PREDICTED: WPP domain-associated protein isoform X1 [Eucalyptus grandis] ref|XP_010056984.1| PREDICTED: WPP domain-associated protein isoform X1 [Eucalyptus grandis] gb|KCW73918.1| hypothetical protein EUGRSUZ_E02503 [Eucalyptus grandis] gb|KCW73919.1| hypothetical protein EUGRSUZ_E02503 [Eucalyptus grandis] Length = 897 Score = 63.5 bits (153), Expect = 4e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLK 286 I LDHYSP+LQHYPG+ME+L+LVRREL+GESLK Sbjct: 863 IGLDHYSPILQHYPGIMEVLKLVRRELTGESLK 895 >ref|XP_019420011.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Lupinus angustifolius] ref|XP_019420012.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Lupinus angustifolius] ref|XP_019420013.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Lupinus angustifolius] Length = 853 Score = 63.2 bits (152), Expect = 6e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLK 286 IALDHYSP+LQHYPGV+EILEL+RREL+GES K Sbjct: 819 IALDHYSPILQHYPGVIEILELIRRELNGESRK 851 >ref|XP_021722574.1| LOW QUALITY PROTEIN: WPP domain-associated protein-like, partial [Chenopodium quinoa] Length = 802 Score = 62.8 bits (151), Expect = 8e-09 Identities = 26/34 (76%), Positives = 34/34 (100%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLKA 283 +ALDHYSP+LQHYPG++EIL+LV+RELSGE++KA Sbjct: 768 VALDHYSPILQHYPGIIEILKLVKRELSGEAVKA 801 >ref|XP_021764149.1| WPP domain-associated protein-like [Chenopodium quinoa] Length = 826 Score = 62.8 bits (151), Expect = 8e-09 Identities = 26/34 (76%), Positives = 34/34 (100%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLKA 283 +ALDHYSP+LQHYPG++EIL+LV+RELSGE++KA Sbjct: 792 VALDHYSPILQHYPGIIEILKLVKRELSGEAVKA 825 >ref|XP_013463012.1| WPP domain associated protein [Medicago truncatula] gb|KEH37057.1| WPP domain associated protein [Medicago truncatula] Length = 857 Score = 62.8 bits (151), Expect = 8e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLK 286 +ALDHYSP+LQHYPG++EILELVRREL+GES K Sbjct: 823 VALDHYSPILQHYPGIIEILELVRRELTGESRK 855 >ref|XP_012569941.1| PREDICTED: WPP domain-associated protein isoform X2 [Cicer arietinum] Length = 819 Score = 62.4 bits (150), Expect = 1e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLK 286 +ALDHYSP+LQHYPG++E+LELVRRELSG+S K Sbjct: 785 VALDHYSPILQHYPGIIEVLELVRRELSGDSRK 817 >ref|XP_004486461.1| PREDICTED: WPP domain-associated protein isoform X1 [Cicer arietinum] Length = 857 Score = 62.4 bits (150), Expect = 1e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLK 286 +ALDHYSP+LQHYPG++E+LELVRRELSG+S K Sbjct: 823 VALDHYSPILQHYPGIIEVLELVRRELSGDSRK 855 >gb|PIN01082.1| hypothetical protein CDL12_26417 [Handroanthus impetiginosus] Length = 891 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLK 286 IALDHYSPVL+HYPG++EILELVRRELSGE+ K Sbjct: 846 IALDHYSPVLKHYPGIVEILELVRRELSGEATK 878 >ref|XP_010316952.1| PREDICTED: WPP domain-associated protein [Solanum lycopersicum] Length = 897 Score = 62.4 bits (150), Expect = 1e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 384 IALDHYSPVLQHYPGVMEILELVRRELSGESLK 286 IALDHYSPVLQHYPG+MEIL+L++REL+GES K Sbjct: 858 IALDHYSPVLQHYPGIMEILKLIKRELTGESTK 890