BLASTX nr result
ID: Chrysanthemum21_contig00015585
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00015585 (551 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021997294.1| COBW domain-containing protein 1 isoform X2 ... 57 3e-06 ref|XP_021997293.1| COBW domain-containing protein 1 isoform X1 ... 57 3e-06 >ref|XP_021997294.1| COBW domain-containing protein 1 isoform X2 [Helianthus annuus] Length = 313 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +3 Query: 93 QVRLWLEEMQSDDKYDQDVYCWKGVLSIVSYDELHTVQ 206 +VRLWLEE+ D KYD DVY KGVLS+V+ DELHTVQ Sbjct: 228 KVRLWLEEILWDKKYDMDVYRCKGVLSVVNSDELHTVQ 265 >ref|XP_021997293.1| COBW domain-containing protein 1 isoform X1 [Helianthus annuus] gb|OTG04501.1| putative cobalamin biosynthesis CobW-like protein [Helianthus annuus] Length = 367 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +3 Query: 93 QVRLWLEEMQSDDKYDQDVYCWKGVLSIVSYDELHTVQ 206 +VRLWLEE+ D KYD DVY KGVLS+V+ DELHTVQ Sbjct: 282 KVRLWLEEILWDKKYDMDVYRCKGVLSVVNSDELHTVQ 319