BLASTX nr result
ID: Chrysanthemum21_contig00015527
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00015527 (610 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022000840.1| pentatricopeptide repeat-containing protein ... 81 4e-20 ref|XP_023746062.1| pentatricopeptide repeat-containing protein ... 72 2e-17 ref|XP_021624860.1| pentatricopeptide repeat-containing protein ... 72 5e-17 gb|OAY39723.1| hypothetical protein MANES_10G117500 [Manihot esc... 72 5e-17 ref|XP_018808679.1| PREDICTED: pentatricopeptide repeat-containi... 76 9e-17 ref|XP_021682719.1| pentatricopeptide repeat-containing protein ... 72 9e-17 ref|XP_015883729.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-16 ref|XP_015883728.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-16 ref|XP_011047908.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-16 ref|XP_006389523.1| pentatricopeptide repeat-containing family p... 70 2e-16 ref|XP_012066783.1| pentatricopeptide repeat-containing protein ... 74 2e-16 gb|KDP42446.1| hypothetical protein JCGZ_00243 [Jatropha curcas] 74 3e-16 dbj|GAV84901.1| PPR domain-containing protein/PPR_2 domain-conta... 71 4e-16 ref|XP_019158864.1| PREDICTED: pentatricopeptide repeat-containi... 75 5e-16 ref|XP_019158865.1| PREDICTED: pentatricopeptide repeat-containi... 75 5e-16 ref|XP_010688894.1| PREDICTED: pentatricopeptide repeat-containi... 68 9e-16 gb|OVA14272.1| Pentatricopeptide repeat [Macleaya cordata] 73 2e-15 ref|XP_008393489.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-15 ref|XP_006364114.2| PREDICTED: pentatricopeptide repeat-containi... 70 3e-15 ref|XP_015089656.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-15 >ref|XP_022000840.1| pentatricopeptide repeat-containing protein At3g16610 [Helianthus annuus] gb|OTG01293.1| putative pentatricopeptide (PPR) repeat-containing protein [Helianthus annuus] Length = 791 Score = 80.9 bits (198), Expect(2) = 4e-20 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLAVAL D+SL PGK ILVTKNLRVCV+CHTALKY+STIT RAITVR Sbjct: 726 KLAVALADVSLVPGKAILVTKNLRVCVDCHTALKYMSTITNRAITVR 772 Score = 45.1 bits (105), Expect(2) = 4e-20 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 DT+RFHHFKDG CNCGDF Sbjct: 773 DTVRFHHFKDGTCNCGDF 790 >ref|XP_023746062.1| pentatricopeptide repeat-containing protein At3g16610 [Lactuca sativa] gb|PLY64548.1| hypothetical protein LSAT_6X28020 [Lactuca sativa] Length = 794 Score = 72.0 bits (175), Expect(2) = 2e-17 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLAVA GD+SL GK I VTKNLRVCV+CHTALKY+S I KR ITVR Sbjct: 729 KLAVAFGDVSLRLGKSIFVTKNLRVCVDCHTALKYMSMIMKREITVR 775 Score = 45.1 bits (105), Expect(2) = 2e-17 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 DTIRFHHFKDG CNCGDF Sbjct: 776 DTIRFHHFKDGSCNCGDF 793 >ref|XP_021624860.1| pentatricopeptide repeat-containing protein At3g16610 isoform X1 [Manihot esculenta] ref|XP_021624861.1| pentatricopeptide repeat-containing protein At3g16610 isoform X1 [Manihot esculenta] gb|OAY39722.1| hypothetical protein MANES_10G117500 [Manihot esculenta] Length = 803 Score = 72.4 bits (176), Expect(2) = 5e-17 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLA+A G L+LSP KPILVTKNLRVC +CHTA+K IS ITKR ITVR Sbjct: 738 KLAIAFGLLNLSPNKPILVTKNLRVCGDCHTAIKLISLITKRNITVR 784 Score = 43.1 bits (100), Expect(2) = 5e-17 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 D RFHHFKDGICNCGDF Sbjct: 785 DASRFHHFKDGICNCGDF 802 >gb|OAY39723.1| hypothetical protein MANES_10G117500 [Manihot esculenta] gb|OAY39724.1| hypothetical protein MANES_10G117500 [Manihot esculenta] Length = 758 Score = 72.4 bits (176), Expect(2) = 5e-17 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLA+A G L+LSP KPILVTKNLRVC +CHTA+K IS ITKR ITVR Sbjct: 693 KLAIAFGLLNLSPNKPILVTKNLRVCGDCHTAIKLISLITKRNITVR 739 Score = 43.1 bits (100), Expect(2) = 5e-17 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 D RFHHFKDGICNCGDF Sbjct: 740 DASRFHHFKDGICNCGDF 757 >ref|XP_018808679.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Juglans regia] Length = 824 Score = 75.9 bits (185), Expect(2) = 9e-17 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLA+A G LSLSP K ILVTKNLRVCV+CHTA+KYI+ ITKR ITVR Sbjct: 759 KLAIAFGILSLSPNKSILVTKNLRVCVDCHTAIKYITLITKREITVR 805 Score = 38.9 bits (89), Expect(2) = 9e-17 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 D RFHHF++GICNCGD+ Sbjct: 806 DASRFHHFRNGICNCGDY 823 >ref|XP_021682719.1| pentatricopeptide repeat-containing protein At3g16610 [Hevea brasiliensis] ref|XP_021682720.1| pentatricopeptide repeat-containing protein At3g16610 [Hevea brasiliensis] Length = 803 Score = 71.6 bits (174), Expect(2) = 9e-17 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLA+A G L+L+P KPILVTKNLRVC +CHTA+K IS ITKR ITVR Sbjct: 738 KLAIAFGILNLNPNKPILVTKNLRVCGDCHTAIKLISLITKRNITVR 784 Score = 43.1 bits (100), Expect(2) = 9e-17 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 D RFHHFKDGICNCGDF Sbjct: 785 DASRFHHFKDGICNCGDF 802 >ref|XP_015883729.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610, partial [Ziziphus jujuba] Length = 800 Score = 68.9 bits (167), Expect(2) = 1e-16 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLA+A G L+LSP KPILVTKNLRVC +CH A+K IS IT+R ITVR Sbjct: 735 KLAIAFGILNLSPTKPILVTKNLRVCGDCHAAIKLISLITQRQITVR 781 Score = 45.1 bits (105), Expect(2) = 1e-16 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 DT RFHHFKDGICNCGDF Sbjct: 782 DTSRFHHFKDGICNCGDF 799 >ref|XP_015883728.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Ziziphus jujuba] Length = 312 Score = 68.9 bits (167), Expect(2) = 1e-16 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLA+A G L+LSP KPILVTKNLRVC +CH A+K IS IT+R ITVR Sbjct: 247 KLAIAFGILNLSPTKPILVTKNLRVCGDCHAAIKLISLITQRQITVR 293 Score = 45.1 bits (105), Expect(2) = 1e-16 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 DT RFHHFKDGICNCGDF Sbjct: 294 DTSRFHHFKDGICNCGDF 311 >ref|XP_011047908.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Populus euphratica] ref|XP_011047910.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Populus euphratica] ref|XP_011047911.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Populus euphratica] ref|XP_011047912.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Populus euphratica] ref|XP_011047913.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Populus euphratica] ref|XP_011047914.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Populus euphratica] ref|XP_011047915.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Populus euphratica] ref|XP_011047916.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Populus euphratica] ref|XP_011047917.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Populus euphratica] Length = 799 Score = 70.9 bits (172), Expect(2) = 2e-16 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLA+A G LSLSP K ILVTKNLRVC +CHTA+K+IS +TKR IT+R Sbjct: 734 KLAIAFGILSLSPDKHILVTKNLRVCGDCHTAIKFISLVTKRDITIR 780 Score = 42.7 bits (99), Expect(2) = 2e-16 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 D RFHHFKDGICNCGDF Sbjct: 781 DANRFHHFKDGICNCGDF 798 >ref|XP_006389523.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gb|PNT42985.1| hypothetical protein POPTR_003G006800v3 [Populus trichocarpa] Length = 799 Score = 70.5 bits (171), Expect(2) = 2e-16 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLA+A G LSLSP K I+VTKNLRVC +CHTA+K+IS +TKR ITVR Sbjct: 734 KLAIAFGILSLSPDKHIIVTKNLRVCGDCHTAIKFISLVTKRDITVR 780 Score = 43.1 bits (100), Expect(2) = 2e-16 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 D RFHHFKDGICNCGDF Sbjct: 781 DASRFHHFKDGICNCGDF 798 >ref|XP_012066783.1| pentatricopeptide repeat-containing protein At3g16610 [Jatropha curcas] ref|XP_020533230.1| pentatricopeptide repeat-containing protein At3g16610 [Jatropha curcas] Length = 800 Score = 74.3 bits (181), Expect(2) = 2e-16 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLA+A G LSLSP KPI+VTKNLRVC +CHTA+K+IS ITKR ITVR Sbjct: 735 KLAIAFGILSLSPNKPIVVTKNLRVCGDCHTAIKFISLITKRNITVR 781 Score = 38.9 bits (89), Expect(2) = 2e-16 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 D RFHHF +GICNCGDF Sbjct: 782 DASRFHHFTNGICNCGDF 799 >gb|KDP42446.1| hypothetical protein JCGZ_00243 [Jatropha curcas] Length = 210 Score = 74.3 bits (181), Expect(2) = 3e-16 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLA+A G LSLSP KPI+VTKNLRVC +CHTA+K+IS ITKR ITVR Sbjct: 145 KLAIAFGILSLSPNKPIVVTKNLRVCGDCHTAIKFISLITKRNITVR 191 Score = 38.9 bits (89), Expect(2) = 3e-16 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 D RFHHF +GICNCGDF Sbjct: 192 DASRFHHFTNGICNCGDF 209 >dbj|GAV84901.1| PPR domain-containing protein/PPR_2 domain-containing protein/DYW_deaminase domain-containing protein, partial [Cephalotus follicularis] Length = 965 Score = 71.2 bits (173), Expect(2) = 4e-16 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLA+A G +SL P KPI+VTKNLRVC +CH A+K+I+ ITKRAITVR Sbjct: 900 KLAIAFGIISLRPSKPIIVTKNLRVCGDCHAAMKFITLITKRAITVR 946 Score = 41.2 bits (95), Expect(2) = 4e-16 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 DT RFHHF+DG CNCGDF Sbjct: 947 DTSRFHHFRDGNCNCGDF 964 >ref|XP_019158864.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 isoform X1 [Ipomoea nil] Length = 804 Score = 75.5 bits (184), Expect(2) = 5e-16 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLAVA L+L P KPILVTKNLRVCV+CHTALK+I+TITKR ITVR Sbjct: 739 KLAVAFALLNLKPSKPILVTKNLRVCVDCHTALKFITTITKREITVR 785 Score = 36.6 bits (83), Expect(2) = 5e-16 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 D RFHHF+DG+C+C DF Sbjct: 786 DASRFHHFRDGVCSCKDF 803 >ref|XP_019158865.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 isoform X2 [Ipomoea nil] Length = 803 Score = 75.5 bits (184), Expect(2) = 5e-16 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLAVA L+L P KPILVTKNLRVCV+CHTALK+I+TITKR ITVR Sbjct: 739 KLAVAFALLNLKPSKPILVTKNLRVCVDCHTALKFITTITKREITVR 785 Score = 36.6 bits (83), Expect(2) = 5e-16 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 D RFHHF+DG+C+C DF Sbjct: 786 DASRFHHFRDGVCSCKDF 803 >ref|XP_010688894.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Beta vulgaris subsp. vulgaris] ref|XP_019107427.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Beta vulgaris subsp. vulgaris] ref|XP_019107428.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Beta vulgaris subsp. vulgaris] ref|XP_019107429.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Beta vulgaris subsp. vulgaris] gb|KMT02462.1| hypothetical protein BVRB_9g204100 [Beta vulgaris subsp. vulgaris] Length = 807 Score = 68.2 bits (165), Expect(2) = 9e-16 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLA+A +SLSP +PI VTKNLRVC +CH A+KYI+ +TKR ITVR Sbjct: 742 KLAIAFATISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVR 788 Score = 43.1 bits (100), Expect(2) = 9e-16 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 DT RFHHFKDG CNCGDF Sbjct: 789 DTSRFHHFKDGACNCGDF 806 >gb|OVA14272.1| Pentatricopeptide repeat [Macleaya cordata] Length = 725 Score = 73.2 bits (178), Expect(2) = 2e-15 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLA+A G LSLSP KPI VTKNLRVC +CHTA+K+I+ IT RAITVR Sbjct: 621 KLAIAFGILSLSPSKPIFVTKNLRVCRDCHTAIKFITKITNRAITVR 667 Score = 37.4 bits (85), Expect(2) = 2e-15 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 D RFHHF+ G CNCGDF Sbjct: 668 DATRFHHFRGGSCNCGDF 685 >ref|XP_008393489.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Malus domestica] Length = 819 Score = 70.9 bits (172), Expect(2) = 3e-15 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVRGI 286 KLA+A L LSPGKPILVTKNLRVC +CH A+K+I+ +TKR ITVR + Sbjct: 754 KLAIAYAILCLSPGKPILVTKNLRVCGDCHAAIKFITLVTKREITVRDV 802 Score = 38.9 bits (89), Expect(2) = 3e-15 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 D RFHHFKDGIC+C DF Sbjct: 801 DVSRFHHFKDGICSCADF 818 >ref|XP_006364114.2| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Solanum tuberosum] Length = 805 Score = 69.7 bits (169), Expect(2) = 3e-15 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLAVA L+L P K ILVTKNLRVCV+CH+ LKYIS ITKR ITVR Sbjct: 740 KLAVAFALLNLDPSKSILVTKNLRVCVDCHSTLKYISLITKREITVR 786 Score = 40.0 bits (92), Expect(2) = 3e-15 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 D RFHHF+DGIC+CGDF Sbjct: 787 DASRFHHFRDGICSCGDF 804 >ref|XP_015089656.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Solanum pennellii] Length = 804 Score = 69.7 bits (169), Expect(2) = 3e-15 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = +2 Query: 140 KLAVALGDLSLSPGKPILVTKNLRVCVNCHTALKYISTITKRAITVR 280 KLAVA L+L P K ILVTKNLRVCV+CH+ LKYIS ITKR ITVR Sbjct: 739 KLAVAFALLNLDPSKSILVTKNLRVCVDCHSTLKYISLITKREITVR 785 Score = 40.0 bits (92), Expect(2) = 3e-15 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +1 Query: 283 DTIRFHHFKDGICNCGDF 336 D RFHHF+DGIC+CGDF Sbjct: 786 DASRFHHFRDGICSCGDF 803