BLASTX nr result
ID: Chrysanthemum21_contig00015513
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00015513 (709 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022035451.1| phytochrome A-associated F-box protein [Heli... 100 2e-21 gb|KVI12509.1| F-box domain, cyclin-like protein [Cynara cardunc... 100 3e-21 ref|XP_023747850.1| phytochrome A-associated F-box protein-like ... 98 9e-21 ref|XP_023747849.1| phytochrome A-associated F-box protein-like ... 98 2e-20 ref|XP_023772844.1| phytochrome A-associated F-box protein-like ... 94 7e-19 ref|XP_009779632.1| PREDICTED: phytochrome A-associated F-box pr... 92 2e-18 ref|XP_009591644.1| PREDICTED: phytochrome A-associated F-box pr... 92 2e-18 ref|XP_019247236.1| PREDICTED: phytochrome A-associated F-box pr... 91 1e-17 ref|XP_016505155.1| PREDICTED: phytochrome A-associated F-box pr... 90 2e-17 ref|XP_015891879.1| PREDICTED: phytochrome A-associated F-box pr... 90 2e-17 ref|XP_020550372.1| phytochrome A-associated F-box protein [Sesa... 89 3e-17 ref|XP_016565766.1| PREDICTED: phytochrome A-associated F-box pr... 89 3e-17 gb|PHU21984.1| Phytochrome A-associated F-box protein [Capsicum ... 89 4e-17 gb|PHT86170.1| Phytochrome A-associated F-box protein [Capsicum ... 89 4e-17 gb|PHT38715.1| Phytochrome A-associated F-box protein [Capsicum ... 89 4e-17 ref|XP_015086259.1| PREDICTED: phytochrome A-associated F-box pr... 89 4e-17 ref|XP_019188504.1| PREDICTED: phytochrome A-associated F-box pr... 89 4e-17 gb|PIN04579.1| hypothetical protein CDL12_22888 [Handroanthus im... 89 5e-17 gb|KNA11550.1| hypothetical protein SOVF_134000 [Spinacia oleracea] 89 6e-17 ref|XP_022727522.1| phytochrome A-associated F-box protein-like ... 88 7e-17 >ref|XP_022035451.1| phytochrome A-associated F-box protein [Helianthus annuus] gb|OTG29052.1| putative F-box family protein [Helianthus annuus] Length = 344 Score = 100 bits (250), Expect = 2e-21 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVWRTI DGN+SK DLNCA+C SNDVWD+HSAFCLRPAYGFH Sbjct: 268 FKNFKKSRVWRTINDGNRSKTDLNCAFCPSNDVWDLHSAFCLRPAYGFH 316 >gb|KVI12509.1| F-box domain, cyclin-like protein [Cynara cardunculus var. scolymus] Length = 342 Score = 100 bits (249), Expect = 3e-21 Identities = 41/49 (83%), Positives = 47/49 (95%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVWRTI DGN+SKIDLNCA+C+SN+VW++HSAFCLRPAYGFH Sbjct: 266 FKNFKKSRVWRTINDGNRSKIDLNCAFCTSNEVWELHSAFCLRPAYGFH 314 >ref|XP_023747850.1| phytochrome A-associated F-box protein-like isoform X2 [Lactuca sativa] Length = 294 Score = 98.2 bits (243), Expect = 9e-21 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVWRTI DGN+SKIDLNCA+C SN+VWD+ SAFCLRPAYGFH Sbjct: 218 FKNFKKSRVWRTINDGNRSKIDLNCAFCPSNEVWDLQSAFCLRPAYGFH 266 >ref|XP_023747849.1| phytochrome A-associated F-box protein-like isoform X1 [Lactuca sativa] gb|PLY63091.1| hypothetical protein LSAT_8X53521 [Lactuca sativa] Length = 338 Score = 98.2 bits (243), Expect = 2e-20 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVWRTI DGN+SKIDLNCA+C SN+VWD+ SAFCLRPAYGFH Sbjct: 262 FKNFKKSRVWRTINDGNRSKIDLNCAFCPSNEVWDLQSAFCLRPAYGFH 310 >ref|XP_023772844.1| phytochrome A-associated F-box protein-like [Lactuca sativa] gb|PLY78516.1| hypothetical protein LSAT_5X191140 [Lactuca sativa] Length = 340 Score = 94.0 bits (232), Expect = 7e-19 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FK+FK SRVWRTIKDGN+S+IDLNCAYCS + V+D+H+AFCLRPAYGFH Sbjct: 264 FKDFKRSRVWRTIKDGNRSRIDLNCAYCSISQVYDLHAAFCLRPAYGFH 312 >ref|XP_009779632.1| PREDICTED: phytochrome A-associated F-box protein [Nicotiana sylvestris] Length = 333 Score = 92.4 bits (228), Expect = 2e-18 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVWRTI DGN+ KIDLNCA+CSSN WD+HSAFCLR +GFH Sbjct: 257 FKNFKQSRVWRTINDGNRKKIDLNCAFCSSNQTWDLHSAFCLRRYFGFH 305 >ref|XP_009591644.1| PREDICTED: phytochrome A-associated F-box protein [Nicotiana tomentosiformis] ref|XP_016468270.1| PREDICTED: phytochrome A-associated F-box protein-like [Nicotiana tabacum] Length = 333 Score = 92.4 bits (228), Expect = 2e-18 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVWRTI DGN+ KIDLNCA+CSSN WD+HSAFCLR +GFH Sbjct: 257 FKNFKQSRVWRTINDGNRKKIDLNCAFCSSNQTWDLHSAFCLRRYFGFH 305 >ref|XP_019247236.1| PREDICTED: phytochrome A-associated F-box protein [Nicotiana attenuata] gb|OIT08094.1| phytochrome a-associated f-box protein [Nicotiana attenuata] Length = 332 Score = 90.5 bits (223), Expect = 1e-17 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVWRTI DGN+ KIDLNCA+CSS+ WD+HSAFCLR +GFH Sbjct: 256 FKNFKQSRVWRTINDGNRKKIDLNCAFCSSHQTWDLHSAFCLRRYFGFH 304 >ref|XP_016505155.1| PREDICTED: phytochrome A-associated F-box protein-like [Nicotiana tabacum] Length = 333 Score = 90.1 bits (222), Expect = 2e-17 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVWRTI DG + KIDLNCA+CSSN WD+HSAFCLR +GFH Sbjct: 257 FKNFKQSRVWRTINDGKRKKIDLNCAFCSSNQTWDLHSAFCLRRYFGFH 305 >ref|XP_015891879.1| PREDICTED: phytochrome A-associated F-box protein [Ziziphus jujuba] Length = 336 Score = 90.1 bits (222), Expect = 2e-17 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK S+VWRTIKDGN+SKIDLNCA+C D WD+HSAFCLR +GFH Sbjct: 260 FKNFKGSQVWRTIKDGNRSKIDLNCAFCPCKDTWDLHSAFCLRRVFGFH 308 >ref|XP_020550372.1| phytochrome A-associated F-box protein [Sesamum indicum] Length = 325 Score = 89.4 bits (220), Expect = 3e-17 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVWRTI DGN+SKIDLNCA+C+S WD+HS+FCLR +GFH Sbjct: 249 FKNFKQSRVWRTINDGNRSKIDLNCAFCASKQTWDLHSSFCLRRYFGFH 297 >ref|XP_016565766.1| PREDICTED: phytochrome A-associated F-box protein-like [Capsicum annuum] Length = 312 Score = 89.0 bits (219), Expect = 3e-17 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVWRTI DGN+ KIDLNCA+CSS WD+HSAFCLR +G+H Sbjct: 236 FKNFKQSRVWRTINDGNRKKIDLNCAFCSSKQTWDLHSAFCLRRYFGYH 284 >gb|PHU21984.1| Phytochrome A-associated F-box protein [Capsicum chinense] Length = 326 Score = 89.0 bits (219), Expect = 4e-17 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVWRTI DGN+ KIDLNCA+CSS WD+HSAFCLR +G+H Sbjct: 250 FKNFKQSRVWRTINDGNRKKIDLNCAFCSSKQTWDLHSAFCLRRYFGYH 298 >gb|PHT86170.1| Phytochrome A-associated F-box protein [Capsicum annuum] Length = 326 Score = 89.0 bits (219), Expect = 4e-17 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVWRTI DGN+ KIDLNCA+CSS WD+HSAFCLR +G+H Sbjct: 250 FKNFKQSRVWRTINDGNRKKIDLNCAFCSSKQTWDLHSAFCLRRYFGYH 298 >gb|PHT38715.1| Phytochrome A-associated F-box protein [Capsicum baccatum] Length = 326 Score = 89.0 bits (219), Expect = 4e-17 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVWRTI DGN+ KIDLNCA+CSS WD+HSAFCLR +G+H Sbjct: 250 FKNFKQSRVWRTINDGNRKKIDLNCAFCSSKQTWDLHSAFCLRRYFGYH 298 >ref|XP_015086259.1| PREDICTED: phytochrome A-associated F-box protein [Solanum pennellii] Length = 326 Score = 89.0 bits (219), Expect = 4e-17 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVWRTI DGN+ KIDLNCA+CSS WD+HSAFCLR +G+H Sbjct: 250 FKNFKQSRVWRTINDGNRKKIDLNCAFCSSKQTWDLHSAFCLRRYFGYH 298 >ref|XP_019188504.1| PREDICTED: phytochrome A-associated F-box protein [Ipomoea nil] Length = 334 Score = 89.0 bits (219), Expect = 4e-17 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVWRTI DGN+ KIDLNCA+C+S WD+HSAFCLR +GFH Sbjct: 258 FKNFKQSRVWRTINDGNRKKIDLNCAFCNSKQTWDLHSAFCLRRYFGFH 306 >gb|PIN04579.1| hypothetical protein CDL12_22888 [Handroanthus impetiginosus] Length = 326 Score = 88.6 bits (218), Expect = 5e-17 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVWRTI DGN+SKIDLNC +CSS WD+HS+FCLR +G+H Sbjct: 250 FKNFKQSRVWRTINDGNRSKIDLNCVFCSSKQTWDLHSSFCLRRCFGYH 298 >gb|KNA11550.1| hypothetical protein SOVF_134000 [Spinacia oleracea] Length = 369 Score = 89.0 bits (219), Expect = 6e-17 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK +RVWRTI DGN+SKI LNCA+CS N+VWD+HSAFCL+ +GFH Sbjct: 293 FKNFKRTRVWRTINDGNRSKIVLNCAFCSCNEVWDLHSAFCLKRGFGFH 341 >ref|XP_022727522.1| phytochrome A-associated F-box protein-like [Durio zibethinus] ref|XP_022727523.1| phytochrome A-associated F-box protein-like [Durio zibethinus] Length = 327 Score = 88.2 bits (217), Expect = 7e-17 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = -3 Query: 707 FKNFKMSRVWRTIKDGNKSKIDLNCAYCSSNDVWDMHSAFCLRPAYGFH 561 FKNFK SRVW+T+ DGN+SKIDLNC++CS D WD+HSAFCLR +G+H Sbjct: 251 FKNFKKSRVWKTLNDGNRSKIDLNCSFCSCKDTWDLHSAFCLRRVFGYH 299