BLASTX nr result
ID: Chrysanthemum21_contig00014969
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00014969 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022028271.1| pentatricopeptide repeat-containing protein ... 87 2e-17 gb|KVI02130.1| Pentatricopeptide repeat-containing protein [Cyna... 65 1e-09 ref|XP_023756520.1| pentatricopeptide repeat-containing protein ... 61 2e-08 >ref|XP_022028271.1| pentatricopeptide repeat-containing protein At3g14580, mitochondrial-like [Helianthus annuus] Length = 399 Score = 87.0 bits (214), Expect = 2e-17 Identities = 47/66 (71%), Positives = 50/66 (75%), Gaps = 7/66 (10%) Frame = -2 Query: 179 MITRSI----IKLRKLHSFFICST---CYHHSVATLESCKKPDPLDLRNHKDWLSPTEVV 21 MI RSI I LR +H FFI ST CYH S+A L SCKKPDPLDLRNHKDWLSPTE + Sbjct: 1 MIPRSISTFTINLRTIHLFFIESTGHYCYH-SIAPLNSCKKPDPLDLRNHKDWLSPTEAI 59 Query: 20 KIFETL 3 KIFETL Sbjct: 60 KIFETL 65 >gb|KVI02130.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 383 Score = 64.7 bits (156), Expect = 1e-09 Identities = 35/63 (55%), Positives = 44/63 (69%), Gaps = 4/63 (6%) Frame = -2 Query: 179 MITRSII----KLRKLHSFFICSTCYHHSVATLESCKKPDPLDLRNHKDWLSPTEVVKIF 12 MITRSII KLRK++ ++HS A+++S KP P +L +HKDWLSP EVVKIF Sbjct: 1 MITRSIIASTAKLRKIYQLN-----WYHSAASIDSSTKPHPFNLLDHKDWLSPNEVVKIF 55 Query: 11 ETL 3 ETL Sbjct: 56 ETL 58 >ref|XP_023756520.1| pentatricopeptide repeat-containing protein At3g14580, mitochondrial [Lactuca sativa] gb|PLY90873.1| hypothetical protein LSAT_9X101401 [Lactuca sativa] Length = 372 Score = 61.2 bits (147), Expect = 2e-08 Identities = 34/60 (56%), Positives = 43/60 (71%), Gaps = 1/60 (1%) Frame = -2 Query: 179 MITRSII-KLRKLHSFFICSTCYHHSVATLESCKKPDPLDLRNHKDWLSPTEVVKIFETL 3 MI+RSI+ KL K++ ++ S A+L S K DPL+L NHKDWLSPTEV+KIFETL Sbjct: 1 MISRSIVTKLPKIN------LKWYRSTASLNSSIKLDPLELHNHKDWLSPTEVIKIFETL 54