BLASTX nr result
ID: Chrysanthemum21_contig00014965
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00014965 (589 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022008690.1| uncharacterized protein LOC110908092 [Helian... 56 6e-06 >ref|XP_022008690.1| uncharacterized protein LOC110908092 [Helianthus annuus] gb|OTF96959.1| Protein of unknown function (DUF1664) [Helianthus annuus] Length = 312 Score = 56.2 bits (134), Expect = 6e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -3 Query: 578 KDKPVLTKTSTKVNKDLDKSKSRFHRPYSMGLSFA 474 K+ PVLTK STKVNKD D +KSRF RPY +GLSFA Sbjct: 275 KENPVLTKMSTKVNKDQDNAKSRFRRPYPVGLSFA 309