BLASTX nr result
ID: Chrysanthemum21_contig00014713
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00014713 (884 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021974083.1| protein prenyltransferase alpha subunit repe... 64 6e-08 >ref|XP_021974083.1| protein prenyltransferase alpha subunit repeat-containing protein 1 [Helianthus annuus] gb|OTG21467.1| putative protein prenylyltransferase superfamily protein [Helianthus annuus] Length = 409 Score = 64.3 bits (155), Expect = 6e-08 Identities = 33/50 (66%), Positives = 34/50 (68%) Frame = -3 Query: 882 AATYITWLIKQMDKPQSMXXXXXXXXXXXXVLNKVCPEKAFLWDLARIKS 733 AATYI WLIKQMD+ QSM VLNKVCP KAFLWDL RIKS Sbjct: 357 AATYIMWLIKQMDELQSMEIREKVGEEIEEVLNKVCPNKAFLWDLVRIKS 406