BLASTX nr result
ID: Chrysanthemum21_contig00014586
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00014586 (784 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAK59803.1| acetyl-CoA carboxylase, partial [Lotus corniculatus] 73 3e-13 gb|ACL68373.1| plastid ACC-1, partial [Triticum monococcum subsp... 70 5e-12 gb|AMQ66375.1| plastid acetyl-CoA carboxylase, partial [Secale c... 71 8e-12 gb|ALF62611.1| plastid acetyl-CoA carboxylase, partial [Anthosac... 70 8e-12 gb|ALE66834.1| plastid acetyl-CoA carboxylase, partial [Anthosac... 70 8e-12 emb|CED80000.1| Acetyl-CoA-carboxylase, partial [Stipa pennata s... 70 9e-12 emb|CED79985.1| Acetyl-CoA-carboxylase, partial [Neomolinia mand... 70 1e-11 gb|ACL68383.1| plastid ACC-1, partial [Triticum monococcum] 70 1e-11 gb|ACL68397.1| plastid ACC-1, partial [Triticum urartu] 70 1e-11 gb|AMQ66374.1| plastid acetyl-CoA carboxylase, partial [Psathyro... 71 1e-11 gb|ALT14121.1| plastid acetyl-CoA carboxylase, partial [Anthosac... 70 1e-11 gb|ALT14116.1| plastid acetyl-CoA carboxylase, partial [Anthosac... 70 1e-11 gb|ALT14112.1| plastid acetyl-CoA carboxylase, partial [Anthosac... 70 1e-11 gb|ALT14107.1| plastid acetyl-CoA carboxylase, partial [Anthosac... 70 1e-11 gb|ALT14100.1| plastid acetyl-CoA carboxylase, partial [Anthosac... 70 1e-11 gb|ALT14093.1| plastid acetyl-CoA carboxylase, partial [Anthosac... 70 1e-11 gb|ALT14088.1| plastid acetyl-CoA carboxylase, partial [Anthosac... 70 1e-11 gb|ALT14087.1| plastid acetyl-CoA carboxylase, partial [Anthosac... 70 1e-11 gb|ALT14078.1| plastid acetyl-CoA carboxylase, partial [Anthosac... 70 1e-11 gb|ALT14074.1| plastid acetyl-CoA carboxylase, partial [Anthosac... 70 1e-11 >gb|AAK59803.1| acetyl-CoA carboxylase, partial [Lotus corniculatus] Length = 57 Score = 72.8 bits (177), Expect = 3e-13 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 VTSEDPDDGFKPTGGKVQELSFK KPNVWAYF VK Sbjct: 11 VTSEDPDDGFKPTGGKVQELSFKSKPNVWAYFSVK 45 >gb|ACL68373.1| plastid ACC-1, partial [Triticum monococcum subsp. aegilopoides] Length = 79 Score = 70.1 bits (170), Expect = 5e-12 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 45 ITSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVK 79 >gb|AMQ66375.1| plastid acetyl-CoA carboxylase, partial [Secale cereale] Length = 138 Score = 71.2 bits (173), Expect = 8e-12 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVKVI 113 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK + Sbjct: 77 ITSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVKAV 113 >gb|ALF62611.1| plastid acetyl-CoA carboxylase, partial [Anthosachne rectiseta] Length = 112 Score = 70.5 bits (171), Expect = 8e-12 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 49 ITSEDPDDGFKPTGGKVKEISFKCKPNVWAYFSVK 83 >gb|ALE66834.1| plastid acetyl-CoA carboxylase, partial [Anthosachne scabra] Length = 112 Score = 70.5 bits (171), Expect = 8e-12 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 49 ITSEDPDDGFKPTGGKVKEISFKCKPNVWAYFSVK 83 >emb|CED80000.1| Acetyl-CoA-carboxylase, partial [Stipa pennata subsp. eriocaulis] Length = 116 Score = 70.5 bits (171), Expect = 9e-12 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 VTSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 49 VTSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVK 83 >emb|CED79985.1| Acetyl-CoA-carboxylase, partial [Neomolinia mandshurica] Length = 110 Score = 70.1 bits (170), Expect = 1e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 45 ITSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVK 79 >gb|ACL68383.1| plastid ACC-1, partial [Triticum monococcum] Length = 110 Score = 70.1 bits (170), Expect = 1e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 63 ITSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVK 97 >gb|ACL68397.1| plastid ACC-1, partial [Triticum urartu] Length = 111 Score = 70.1 bits (170), Expect = 1e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 77 ITSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVK 111 >gb|AMQ66374.1| plastid acetyl-CoA carboxylase, partial [Psathyrostachys juncea] Length = 153 Score = 71.2 bits (173), Expect = 1e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVKVI 113 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK + Sbjct: 93 ITSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVKAV 129 >gb|ALT14121.1| plastid acetyl-CoA carboxylase, partial [Anthosachne rectiseta] Length = 112 Score = 70.1 bits (170), Expect = 1e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 49 ITSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVK 83 >gb|ALT14116.1| plastid acetyl-CoA carboxylase, partial [Anthosachne rectiseta] Length = 112 Score = 70.1 bits (170), Expect = 1e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 49 ITSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVK 83 >gb|ALT14112.1| plastid acetyl-CoA carboxylase, partial [Anthosachne rectiseta] Length = 112 Score = 70.1 bits (170), Expect = 1e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 49 ITSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVK 83 >gb|ALT14107.1| plastid acetyl-CoA carboxylase, partial [Anthosachne rectiseta] Length = 112 Score = 70.1 bits (170), Expect = 1e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 49 ITSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVK 83 >gb|ALT14100.1| plastid acetyl-CoA carboxylase, partial [Anthosachne scabra] Length = 112 Score = 70.1 bits (170), Expect = 1e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 49 ITSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVK 83 >gb|ALT14093.1| plastid acetyl-CoA carboxylase, partial [Anthosachne scabra] Length = 112 Score = 70.1 bits (170), Expect = 1e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 49 ITSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVK 83 >gb|ALT14088.1| plastid acetyl-CoA carboxylase, partial [Anthosachne plurinervis] Length = 112 Score = 70.1 bits (170), Expect = 1e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 49 ITSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVK 83 >gb|ALT14087.1| plastid acetyl-CoA carboxylase, partial [Anthosachne plurinervis] Length = 112 Score = 70.1 bits (170), Expect = 1e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 49 ITSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVK 83 >gb|ALT14078.1| plastid acetyl-CoA carboxylase, partial [Anthosachne scabra] Length = 112 Score = 70.1 bits (170), Expect = 1e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 49 ITSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVK 83 >gb|ALT14074.1| plastid acetyl-CoA carboxylase, partial [Anthosachne scabra] gb|ALT14092.1| plastid acetyl-CoA carboxylase, partial [Anthosachne scabra] gb|ALT14095.1| plastid acetyl-CoA carboxylase, partial [Anthosachne scabra] gb|ALT14098.1| plastid acetyl-CoA carboxylase, partial [Anthosachne scabra] gb|ALT14119.1| plastid acetyl-CoA carboxylase, partial [Anthosachne rectiseta] gb|ALT14124.1| plastid acetyl-CoA carboxylase, partial [Anthosachne rectiseta] Length = 112 Score = 70.1 bits (170), Expect = 1e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 VTSEDPDDGFKPTGGKVQELSFKIKPNVWAYFFVK 107 +TSEDPDDGFKPTGGKV+E+SFK KPNVWAYF VK Sbjct: 49 ITSEDPDDGFKPTGGKVKEISFKSKPNVWAYFSVK 83