BLASTX nr result
ID: Chrysanthemum21_contig00014503
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00014503 (376 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH99582.1| Glycosyl transferase, family 28 [Cynara carduncul... 58 3e-07 >gb|KVH99582.1| Glycosyl transferase, family 28 [Cynara cardunculus var. scolymus] Length = 616 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/40 (62%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -1 Query: 376 LPPDIALSSTPPSKQ-DDEEYTDPIQWFFTQIALHCGCGS 260 LP D+ LSST PSKQ DD+++ +P+QW FTQI L+CGCG+ Sbjct: 576 LPADMPLSSTLPSKQEDDDDHPNPLQWLFTQIGLYCGCGT 615