BLASTX nr result
ID: Chrysanthemum21_contig00014428
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00014428 (800 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PRQ24233.1| putative phosphotransferase with paired acceptor ... 120 9e-31 ref|XP_024164149.1| alpha-glucan water dikinase, chloroplastic-l... 120 1e-29 gb|AAY89386.1| glucan water dikinase precursor, partial [Nicotia... 119 3e-29 gb|OTG33059.1| putative pyruvate, phosphate dikinase [Helianthus... 117 3e-29 gb|KHG20916.1| Alpha-glucan water dikinase, chloroplastic [Gossy... 120 7e-29 ref|XP_022031673.1| alpha-glucan water dikinase 1, chloroplastic... 117 7e-29 ref|XP_018503606.1| PREDICTED: alpha-glucan water dikinase, chlo... 120 2e-28 gb|KHG23044.1| Alpha-glucan water dikinase, chloroplastic [Gossy... 118 5e-28 gb|PKI48101.1| hypothetical protein CRG98_031506 [Punica granatum] 116 6e-28 ref|XP_024009074.1| alpha-glucan water dikinase 1, chloroplastic... 122 1e-27 ref|XP_024009073.1| alpha-glucan water dikinase 1, chloroplastic... 122 1e-27 gb|ESQ35773.1| hypothetical protein EUTSA_v10006565mg [Eutrema s... 122 1e-27 ref|XP_022558773.1| alpha-glucan water dikinase 1, chloroplastic... 122 1e-27 ref|XP_013604506.1| PREDICTED: alpha-glucan water dikinase 1, ch... 122 1e-27 emb|CDY20967.1| BnaA08g25580D [Brassica napus] 122 1e-27 emb|CDY20604.1| BnaC08g14540D [Brassica napus] 122 1e-27 emb|CDY34849.1| BnaA09g47750D [Brassica napus] 122 1e-27 emb|CDY66790.1| BnaC08g49610D [Brassica napus] 122 1e-27 ref|XP_009118209.2| PREDICTED: alpha-glucan water dikinase 1, ch... 122 1e-27 ref|XP_009144413.1| PREDICTED: alpha-glucan water dikinase 1, ch... 122 1e-27 >gb|PRQ24233.1| putative phosphotransferase with paired acceptor [Rosa chinensis] Length = 134 Score = 120 bits (302), Expect = 9e-31 Identities = 56/61 (91%), Positives = 60/61 (98%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFST+KVKLDHD+LCMAVLVQE+INADYAFVIHTTNPSSGDSSEIYA Sbjct: 24 IKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIYA 83 Query: 238 E 236 E Sbjct: 84 E 84 >ref|XP_024164149.1| alpha-glucan water dikinase, chloroplastic-like [Rosa chinensis] Length = 219 Score = 120 bits (302), Expect = 1e-29 Identities = 56/61 (91%), Positives = 60/61 (98%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFST+KVKLDHD+LCMAVLVQE+INADYAFVIHTTNPSSGDSSEIYA Sbjct: 108 IKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIYA 167 Query: 238 E 236 E Sbjct: 168 E 168 >gb|AAY89386.1| glucan water dikinase precursor, partial [Nicotiana langsdorffii x Nicotiana sanderae] Length = 206 Score = 119 bits (298), Expect = 3e-29 Identities = 55/61 (90%), Positives = 59/61 (96%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFST+KVKLDHD+LCMAVLVQE+INADYAFVIHTTNPSSGDSSEIY Sbjct: 75 IKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIYV 134 Query: 238 E 236 E Sbjct: 135 E 135 >gb|OTG33059.1| putative pyruvate, phosphate dikinase [Helianthus annuus] Length = 140 Score = 117 bits (292), Expect = 3e-29 Identities = 55/63 (87%), Positives = 59/63 (93%) Frame = -2 Query: 424 IFIFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEI 245 I I +VWASKWN+RAYFST+KVKLDHD LCMAVLVQE+INADYAFVIHTTNPSSGD SEI Sbjct: 31 IAIKKVWASKWNKRAYFSTRKVKLDHDLLCMAVLVQEIINADYAFVIHTTNPSSGDPSEI 90 Query: 244 YAE 236 YAE Sbjct: 91 YAE 93 >gb|KHG20916.1| Alpha-glucan water dikinase, chloroplastic [Gossypium arboreum] Length = 270 Score = 120 bits (300), Expect = 7e-29 Identities = 56/61 (91%), Positives = 60/61 (98%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFST+KVKLDHD+LCMAVLVQEVINADYAFVIHTTNPSSGD+SEIYA Sbjct: 73 IKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDTSEIYA 132 Query: 238 E 236 E Sbjct: 133 E 133 >ref|XP_022031673.1| alpha-glucan water dikinase 1, chloroplastic-like [Helianthus annuus] Length = 166 Score = 117 bits (292), Expect = 7e-29 Identities = 55/63 (87%), Positives = 59/63 (93%) Frame = -2 Query: 424 IFIFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEI 245 I I +VWASKWN+RAYFST+KVKLDHD LCMAVLVQE+INADYAFVIHTTNPSSGD SEI Sbjct: 39 IAIKKVWASKWNKRAYFSTRKVKLDHDLLCMAVLVQEIINADYAFVIHTTNPSSGDPSEI 98 Query: 244 YAE 236 YAE Sbjct: 99 YAE 101 >ref|XP_018503606.1| PREDICTED: alpha-glucan water dikinase, chloroplastic, partial [Pyrus x bretschneideri] Length = 350 Score = 120 bits (302), Expect = 2e-28 Identities = 56/61 (91%), Positives = 60/61 (98%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFST+KVKLDHD+LCMAVLVQE+INADYAFVIHTTNPSSGDSSEIYA Sbjct: 153 IKKVWASKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIYA 212 Query: 238 E 236 E Sbjct: 213 E 213 >gb|KHG23044.1| Alpha-glucan water dikinase, chloroplastic [Gossypium arboreum] Length = 286 Score = 118 bits (295), Expect = 5e-28 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFST+K KLDH++LCMAVLVQE+INADYAFVIHTTNPSSGDSSEIYA Sbjct: 89 ITKVWASKWNERAYFSTRKAKLDHEYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIYA 148 Query: 238 E 236 E Sbjct: 149 E 149 >gb|PKI48101.1| hypothetical protein CRG98_031506 [Punica granatum] Length = 221 Score = 116 bits (290), Expect = 6e-28 Identities = 52/61 (85%), Positives = 59/61 (96%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFST+K+K+DH++LCMAVLVQE+INADYAFVIHTTNPSSGDSSEIY Sbjct: 24 IKKVWASKWNERAYFSTRKIKVDHEYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIYT 83 Query: 238 E 236 E Sbjct: 84 E 84 >ref|XP_024009074.1| alpha-glucan water dikinase 1, chloroplastic isoform X3 [Eutrema salsugineum] Length = 1198 Score = 122 bits (306), Expect = 1e-27 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFSTKKVKLDHD+LCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA Sbjct: 1001 IKKVWASKWNERAYFSTKKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 1060 Query: 238 E 236 E Sbjct: 1061 E 1061 >ref|XP_024009073.1| alpha-glucan water dikinase 1, chloroplastic isoform X2 [Eutrema salsugineum] Length = 1231 Score = 122 bits (306), Expect = 1e-27 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFSTKKVKLDHD+LCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA Sbjct: 1034 IKKVWASKWNERAYFSTKKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 1093 Query: 238 E 236 E Sbjct: 1094 E 1094 >gb|ESQ35773.1| hypothetical protein EUTSA_v10006565mg [Eutrema salsugineum] Length = 1281 Score = 122 bits (306), Expect = 1e-27 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFSTKKVKLDHD+LCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA Sbjct: 1212 IKKVWASKWNERAYFSTKKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 1271 Query: 238 E 236 E Sbjct: 1272 E 1272 >ref|XP_022558773.1| alpha-glucan water dikinase 1, chloroplastic isoform X2 [Brassica napus] ref|XP_022563687.1| alpha-glucan water dikinase 1, chloroplastic isoform X2 [Brassica napus] Length = 1324 Score = 122 bits (306), Expect = 1e-27 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFSTKKVKLDHD+LCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA Sbjct: 1127 IKKVWASKWNERAYFSTKKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 1186 Query: 238 E 236 E Sbjct: 1187 E 1187 >ref|XP_013604506.1| PREDICTED: alpha-glucan water dikinase 1, chloroplastic isoform X2 [Brassica oleracea var. oleracea] Length = 1324 Score = 122 bits (306), Expect = 1e-27 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFSTKKVKLDHD+LCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA Sbjct: 1127 IKKVWASKWNERAYFSTKKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 1186 Query: 238 E 236 E Sbjct: 1187 E 1187 >emb|CDY20967.1| BnaA08g25580D [Brassica napus] Length = 1372 Score = 122 bits (306), Expect = 1e-27 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFSTKKVKLDHD+LCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA Sbjct: 1175 IKKVWASKWNERAYFSTKKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 1234 Query: 238 E 236 E Sbjct: 1235 E 1235 >emb|CDY20604.1| BnaC08g14540D [Brassica napus] Length = 1374 Score = 122 bits (306), Expect = 1e-27 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFSTKKVKLDHD+LCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA Sbjct: 1177 IKKVWASKWNERAYFSTKKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 1236 Query: 238 E 236 E Sbjct: 1237 E 1237 >emb|CDY34849.1| BnaA09g47750D [Brassica napus] Length = 1380 Score = 122 bits (306), Expect = 1e-27 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFSTKKVKLDHD+LCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA Sbjct: 1183 IKKVWASKWNERAYFSTKKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 1242 Query: 238 E 236 E Sbjct: 1243 E 1243 >emb|CDY66790.1| BnaC08g49610D [Brassica napus] Length = 1380 Score = 122 bits (306), Expect = 1e-27 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFSTKKVKLDHD+LCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA Sbjct: 1183 IKKVWASKWNERAYFSTKKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 1242 Query: 238 E 236 E Sbjct: 1243 E 1243 >ref|XP_009118209.2| PREDICTED: alpha-glucan water dikinase 1, chloroplastic [Brassica rapa] Length = 1386 Score = 122 bits (306), Expect = 1e-27 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFSTKKVKLDHD+LCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA Sbjct: 1202 IKKVWASKWNERAYFSTKKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 1261 Query: 238 E 236 E Sbjct: 1262 E 1262 >ref|XP_009144413.1| PREDICTED: alpha-glucan water dikinase 1, chloroplastic [Brassica rapa] Length = 1395 Score = 122 bits (306), Expect = 1e-27 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = -2 Query: 418 IFQVWASKWNERAYFSTKKVKLDHDFLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 239 I +VWASKWNERAYFSTKKVKLDHD+LCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA Sbjct: 1198 IKKVWASKWNERAYFSTKKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYA 1257 Query: 238 E 236 E Sbjct: 1258 E 1258