BLASTX nr result
ID: Chrysanthemum21_contig00014160
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00014160 (545 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI11109.1| hypothetical protein Ccrd_010486, partial [Cynara... 64 2e-10 gb|KVI11096.1| AAA+ ATPase domain-containing protein [Cynara car... 64 7e-10 ref|XP_023736634.1| pleiotropic drug resistance protein 3-like [... 60 4e-09 gb|OTG28956.1| putative pleiotropic drug resistance protein PDR/... 59 2e-08 ref|XP_021993781.1| pleiotropic drug resistance protein 3-like [... 56 5e-08 ref|XP_021993768.1| pleiotropic drug resistance protein 3-like i... 56 8e-08 ref|XP_021993769.1| pleiotropic drug resistance protein 3-like i... 56 8e-08 ref|XP_021993776.1| pleiotropic drug resistance protein 3-like i... 55 8e-08 ref|XP_021993777.1| pleiotropic drug resistance protein 3-like i... 55 8e-08 gb|OTG08249.1| putative pleiotropic drug resistance protein PDR/... 56 8e-08 gb|OTG28961.1| putative pigment precursor permease [Helianthus a... 57 8e-08 ref|XP_021993778.1| pleiotropic drug resistance protein 3-like i... 54 2e-07 ref|XP_021993779.1| pleiotropic drug resistance protein 3-like i... 54 2e-07 gb|PIN02962.1| Pleiotropic drug resistance proteins (PDR1-15), A... 58 5e-07 gb|PIM99606.1| Pleiotropic drug resistance proteins (PDR1-15), A... 55 1e-06 gb|PIN01983.1| Pleiotropic drug resistance proteins (PDR1-15), A... 54 8e-06 >gb|KVI11109.1| hypothetical protein Ccrd_010486, partial [Cynara cardunculus var. scolymus] Length = 166 Score = 64.3 bits (155), Expect(2) = 2e-10 Identities = 36/60 (60%), Positives = 39/60 (65%), Gaps = 5/60 (8%) Frame = +1 Query: 340 RYRKSLAAER-----DIKRKKVVDVTRLLAPERHMFIEKLIKHIENGNXXXXXXXXXRTE 504 R R SL E D+K KKVVDVT+LLAPERHMFIEKLIKHIEN N RT+ Sbjct: 65 RLRSSLFDEENGDGHDVKGKKVVDVTKLLAPERHMFIEKLIKHIENDNLQLLQKLRKRTD 124 Score = 28.5 bits (62), Expect(2) = 2e-10 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 491 KNEPKIVVQLPSVEVRYK 544 K K+ VQLPSVEVRYK Sbjct: 121 KRTDKVGVQLPSVEVRYK 138 >gb|KVI11096.1| AAA+ ATPase domain-containing protein [Cynara cardunculus var. scolymus] Length = 1446 Score = 63.5 bits (153), Expect(2) = 7e-10 Identities = 35/57 (61%), Positives = 39/57 (68%), Gaps = 2/57 (3%) Frame = +1 Query: 340 RYRKSLAAERD--IKRKKVVDVTRLLAPERHMFIEKLIKHIENGNXXXXXXXXXRTE 504 R R SL E + +K KKVVDVT+LLAPERHMFIEKLIKHIEN N RT+ Sbjct: 68 RLRSSLFDEENGHVKGKKVVDVTKLLAPERHMFIEKLIKHIENDNLQLLQKLRKRTD 124 Score = 27.3 bits (59), Expect(2) = 7e-10 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +2 Query: 491 KNEPKIVVQLPSVEVRYK 544 K K+ VQLP+VEVRYK Sbjct: 121 KRTDKVGVQLPTVEVRYK 138 >ref|XP_023736634.1| pleiotropic drug resistance protein 3-like [Lactuca sativa] gb|PLY71618.1| hypothetical protein LSAT_9X87721 [Lactuca sativa] Length = 1449 Score = 59.7 bits (143), Expect(2) = 4e-09 Identities = 34/60 (56%), Positives = 37/60 (61%), Gaps = 5/60 (8%) Frame = +1 Query: 340 RYRKSLAAERDI-----KRKKVVDVTRLLAPERHMFIEKLIKHIENGNXXXXXXXXXRTE 504 R R SL E D + KKVVDVT+LL PERHMFIEKLIKHIEN N RT+ Sbjct: 68 RLRSSLFDEEDADGHDGRGKKVVDVTKLLPPERHMFIEKLIKHIENDNLQLLQKLRKRTD 127 Score = 28.5 bits (62), Expect(2) = 4e-09 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 491 KNEPKIVVQLPSVEVRYK 544 K K+ VQLPSVEVRYK Sbjct: 124 KRTDKVGVQLPSVEVRYK 141 >gb|OTG28956.1| putative pleiotropic drug resistance protein PDR/CDR [Helianthus annuus] Length = 629 Score = 59.3 bits (142), Expect(2) = 2e-08 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +1 Query: 370 DIKRKKVVDVTRLLAPERHMFIEKLIKHIENGNXXXXXXXXXRTE 504 D KKVVDVT+LLAPERHMFIEKLIKHIEN N RT+ Sbjct: 76 DENGKKVVDVTKLLAPERHMFIEKLIKHIENDNLRLLQKLRKRTD 120 Score = 26.9 bits (58), Expect(2) = 2e-08 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +2 Query: 491 KNEPKIVVQLPSVEVRYK 544 K K+ VQLPSVEVR+K Sbjct: 117 KRTDKVGVQLPSVEVRFK 134 >ref|XP_021993781.1| pleiotropic drug resistance protein 3-like [Helianthus annuus] gb|OTG08261.1| putative pleiotropic drug resistance 9 [Helianthus annuus] Length = 1441 Score = 56.2 bits (134), Expect(2) = 5e-08 Identities = 33/61 (54%), Positives = 38/61 (62%) Frame = +1 Query: 322 QLTVQARYRKSLAAERDIKRKKVVDVTRLLAPERHMFIEKLIKHIENGNXXXXXXXXXRT 501 +L+ R R SL E D KKVVDVT+LL ERHMFIEKLIKHIE+ N RT Sbjct: 62 RLSTFERLRSSLFDEED--GKKVVDVTKLLPAERHMFIEKLIKHIEHDNLQLLQKLRKRT 119 Query: 502 E 504 + Sbjct: 120 D 120 Score = 28.5 bits (62), Expect(2) = 5e-08 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 491 KNEPKIVVQLPSVEVRYK 544 K K+ VQLPSVEVRYK Sbjct: 117 KRTDKVGVQLPSVEVRYK 134 >ref|XP_021993768.1| pleiotropic drug resistance protein 3-like isoform X1 [Helianthus annuus] Length = 1456 Score = 55.8 bits (133), Expect(2) = 8e-08 Identities = 32/61 (52%), Positives = 38/61 (62%) Frame = +1 Query: 322 QLTVQARYRKSLAAERDIKRKKVVDVTRLLAPERHMFIEKLIKHIENGNXXXXXXXXXRT 501 +L+ R R SL + + KKVVDVT LL PERHMFIEKLIKHIE+ N RT Sbjct: 62 RLSTFERLRSSLFDDEE-DGKKVVDVTELLPPERHMFIEKLIKHIEHDNLRLLQKLRKRT 120 Query: 502 E 504 + Sbjct: 121 D 121 Score = 28.1 bits (61), Expect(2) = 8e-08 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +2 Query: 491 KNEPKIVVQLPSVEVRYK 544 K K+ +QLPSVEVRYK Sbjct: 118 KRTDKVGIQLPSVEVRYK 135 >ref|XP_021993769.1| pleiotropic drug resistance protein 3-like isoform X2 [Helianthus annuus] Length = 1442 Score = 55.8 bits (133), Expect(2) = 8e-08 Identities = 32/61 (52%), Positives = 38/61 (62%) Frame = +1 Query: 322 QLTVQARYRKSLAAERDIKRKKVVDVTRLLAPERHMFIEKLIKHIENGNXXXXXXXXXRT 501 +L+ R R SL + + KKVVDVT LL PERHMFIEKLIKHIE+ N RT Sbjct: 62 RLSTFERLRSSLFDDEE-DGKKVVDVTELLPPERHMFIEKLIKHIEHDNLRLLQKLRKRT 120 Query: 502 E 504 + Sbjct: 121 D 121 Score = 28.1 bits (61), Expect(2) = 8e-08 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +2 Query: 491 KNEPKIVVQLPSVEVRYK 544 K K+ +QLPSVEVRYK Sbjct: 118 KRTDKVGIQLPSVEVRYK 135 >ref|XP_021993776.1| pleiotropic drug resistance protein 3-like isoform X1 [Helianthus annuus] gb|OTG08256.1| putative pleiotropic drug resistance protein [Helianthus annuus] Length = 1441 Score = 55.5 bits (132), Expect(2) = 8e-08 Identities = 33/61 (54%), Positives = 38/61 (62%) Frame = +1 Query: 322 QLTVQARYRKSLAAERDIKRKKVVDVTRLLAPERHMFIEKLIKHIENGNXXXXXXXXXRT 501 +L+ R R SL E D KKVVDVT+LL ERHMFIEKLIKHIE+ N RT Sbjct: 62 RLSTFERLRSSLFDEED--GKKVVDVTKLLPLERHMFIEKLIKHIEHDNLRLLQKLRKRT 119 Query: 502 E 504 + Sbjct: 120 D 120 Score = 28.5 bits (62), Expect(2) = 8e-08 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 491 KNEPKIVVQLPSVEVRYK 544 K K+ VQLPSVEVRYK Sbjct: 117 KRTDKVGVQLPSVEVRYK 134 >ref|XP_021993777.1| pleiotropic drug resistance protein 3-like isoform X2 [Helianthus annuus] Length = 1356 Score = 55.5 bits (132), Expect(2) = 8e-08 Identities = 33/61 (54%), Positives = 38/61 (62%) Frame = +1 Query: 322 QLTVQARYRKSLAAERDIKRKKVVDVTRLLAPERHMFIEKLIKHIENGNXXXXXXXXXRT 501 +L+ R R SL E D KKVVDVT+LL ERHMFIEKLIKHIE+ N RT Sbjct: 62 RLSTFERLRSSLFDEED--GKKVVDVTKLLPLERHMFIEKLIKHIEHDNLRLLQKLRKRT 119 Query: 502 E 504 + Sbjct: 120 D 120 Score = 28.5 bits (62), Expect(2) = 8e-08 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 491 KNEPKIVVQLPSVEVRYK 544 K K+ VQLPSVEVRYK Sbjct: 117 KRTDKVGVQLPSVEVRYK 134 >gb|OTG08249.1| putative pleiotropic drug resistance protein PDR/CDR [Helianthus annuus] Length = 1212 Score = 55.8 bits (133), Expect(2) = 8e-08 Identities = 32/61 (52%), Positives = 38/61 (62%) Frame = +1 Query: 322 QLTVQARYRKSLAAERDIKRKKVVDVTRLLAPERHMFIEKLIKHIENGNXXXXXXXXXRT 501 +L+ R R SL + + KKVVDVT LL PERHMFIEKLIKHIE+ N RT Sbjct: 62 RLSTFERLRSSLFDDEE-DGKKVVDVTELLPPERHMFIEKLIKHIEHDNLRLLQKLRKRT 120 Query: 502 E 504 + Sbjct: 121 D 121 Score = 28.1 bits (61), Expect(2) = 8e-08 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +2 Query: 491 KNEPKIVVQLPSVEVRYK 544 K K+ +QLPSVEVRYK Sbjct: 118 KRTDKVGIQLPSVEVRYK 135 >gb|OTG28961.1| putative pigment precursor permease [Helianthus annuus] Length = 809 Score = 56.6 bits (135), Expect(2) = 8e-08 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = +1 Query: 370 DIKRKKVVDVTRLLAPERHMFIEKLIKHIENGNXXXXXXXXXRTE 504 D +KVVDVT+LLAPERHMFIE+LIKH+EN N RT+ Sbjct: 75 DENGRKVVDVTKLLAPERHMFIERLIKHVENDNLRLLQKLRNRTD 119 Score = 27.3 bits (59), Expect(2) = 8e-08 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 503 KIVVQLPSVEVRYK 544 K+ VQLPSVEVRYK Sbjct: 120 KVGVQLPSVEVRYK 133 >ref|XP_021993778.1| pleiotropic drug resistance protein 3-like isoform X1 [Helianthus annuus] gb|OTG08258.1| putative pleiotropic drug resistance 5 [Helianthus annuus] Length = 1439 Score = 54.3 bits (129), Expect(2) = 2e-07 Identities = 32/61 (52%), Positives = 38/61 (62%) Frame = +1 Query: 322 QLTVQARYRKSLAAERDIKRKKVVDVTRLLAPERHMFIEKLIKHIENGNXXXXXXXXXRT 501 +L+ R R SL E + KKVVDVT+LL ERHMFIEKLIKHIE+ N RT Sbjct: 62 RLSTFERLRSSLFDEEN--GKKVVDVTKLLPAERHMFIEKLIKHIEHDNLRLLQKLRKRT 119 Query: 502 E 504 + Sbjct: 120 D 120 Score = 28.5 bits (62), Expect(2) = 2e-07 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 491 KNEPKIVVQLPSVEVRYK 544 K K+ VQLPSVEVRYK Sbjct: 117 KRTDKVGVQLPSVEVRYK 134 >ref|XP_021993779.1| pleiotropic drug resistance protein 3-like isoform X2 [Helianthus annuus] Length = 1354 Score = 54.3 bits (129), Expect(2) = 2e-07 Identities = 32/61 (52%), Positives = 38/61 (62%) Frame = +1 Query: 322 QLTVQARYRKSLAAERDIKRKKVVDVTRLLAPERHMFIEKLIKHIENGNXXXXXXXXXRT 501 +L+ R R SL E + KKVVDVT+LL ERHMFIEKLIKHIE+ N RT Sbjct: 62 RLSTFERLRSSLFDEEN--GKKVVDVTKLLPAERHMFIEKLIKHIEHDNLRLLQKLRKRT 119 Query: 502 E 504 + Sbjct: 120 D 120 Score = 28.5 bits (62), Expect(2) = 2e-07 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +2 Query: 491 KNEPKIVVQLPSVEVRYK 544 K K+ VQLPSVEVRYK Sbjct: 117 KRTDKVGVQLPSVEVRYK 134 >gb|PIN02962.1| Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Handroanthus impetiginosus] Length = 1431 Score = 58.2 bits (139), Expect(2) = 5e-07 Identities = 33/60 (55%), Positives = 40/60 (66%), Gaps = 2/60 (3%) Frame = +1 Query: 295 KAYPLILASQLTVQARYRKSLAA--ERDIKRKKVVDVTRLLAPERHMFIEKLIKHIENGN 468 +A+ L +L R R SL E + K K+VVDVT+L APERHMFIEKLIKHIE+ N Sbjct: 51 EAFQLAAIDRLPTFERLRSSLFDDNEDEAKGKRVVDVTKLRAPERHMFIEKLIKHIEHDN 110 Score = 23.1 bits (48), Expect(2) = 5e-07 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 Query: 491 KNEPKIVVQLPSVEVRY 541 K K+ V+LP+VEVRY Sbjct: 119 KRIDKVGVKLPTVEVRY 135 >gb|PIM99606.1| Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Handroanthus impetiginosus] Length = 1396 Score = 55.1 bits (131), Expect(2) = 1e-06 Identities = 31/45 (68%), Positives = 34/45 (75%), Gaps = 2/45 (4%) Frame = +1 Query: 340 RYRKSLAAERDI--KRKKVVDVTRLLAPERHMFIEKLIKHIENGN 468 R R SL E + K KKVVDVT+L APERHMFIEKLIKHIE+ N Sbjct: 68 RLRTSLFDENEDGNKGKKVVDVTKLGAPERHMFIEKLIKHIEHDN 112 Score = 25.0 bits (53), Expect(2) = 1e-06 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 491 KNEPKIVVQLPSVEVRYK 544 K K+ V+LP++EVRYK Sbjct: 121 KRIDKVGVELPTIEVRYK 138 >gb|PIN01983.1| Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Handroanthus impetiginosus] Length = 1437 Score = 54.3 bits (129), Expect(2) = 8e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 364 ERDIKRKKVVDVTRLLAPERHMFIEKLIKHIENGN 468 E + K K+VVDVT+L APERHMFIEKLIKHIE+ N Sbjct: 76 EDEAKGKRVVDVTKLGAPERHMFIEKLIKHIEHDN 110 Score = 22.7 bits (47), Expect(2) = 8e-06 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 491 KNEPKIVVQLPSVEVRY 541 K K+ V+LP++EVRY Sbjct: 119 KRIDKVGVKLPTIEVRY 135