BLASTX nr result
ID: Chrysanthemum21_contig00014058
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00014058 (512 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015871465.1| PREDICTED: helicase-like transcription facto... 75 5e-14 gb|PKI77570.1| hypothetical protein CRG98_002024 [Punica granatum] 75 9e-14 gb|KVH87633.1| Helicase, C-terminal [Cynara cardunculus var. sco... 79 1e-13 gb|PLY99621.1| hypothetical protein LSAT_4X55800 [Lactuca sativa] 78 1e-13 ref|XP_023739690.1| helicase-like transcription factor CHR28 [La... 78 1e-13 ref|XP_007159279.1| hypothetical protein PHAVU_002G224600g [Phas... 78 2e-13 ref|XP_007148208.1| hypothetical protein PHAVU_006G189200g [Phas... 77 2e-13 ref|XP_007148209.1| hypothetical protein PHAVU_006G189200g [Phas... 77 2e-13 gb|KVI00959.1| hypothetical protein Ccrd_020771 [Cynara carduncu... 77 2e-13 ref|XP_022642626.1| helicase-like transcription factor CHR28 iso... 77 3e-13 gb|KYP63025.1| putative ATP-dependent helicase C23E6.02 [Cajanus... 77 3e-13 ref|XP_022642624.1| helicase-like transcription factor CHR28 iso... 77 3e-13 ref|XP_020221969.1| helicase-like transcription factor CHR28 iso... 77 3e-13 ref|XP_022018166.1| helicase-like transcription factor CHR28 iso... 77 3e-13 ref|XP_022018165.1| helicase-like transcription factor CHR28 iso... 77 3e-13 ref|XP_006594608.1| PREDICTED: uncharacterized ATP-dependent hel... 77 3e-13 ref|XP_017436292.1| PREDICTED: helicase-like transcription facto... 77 3e-13 ref|XP_014518410.1| helicase-like transcription factor CHR28 iso... 77 3e-13 gb|KRH10808.1| hypothetical protein GLYMA_15G070100 [Glycine max] 77 3e-13 gb|KOM53821.1| hypothetical protein LR48_Vigan09g248000 [Vigna a... 77 3e-13 >ref|XP_015871465.1| PREDICTED: helicase-like transcription factor CHR28 [Ziziphus jujuba] Length = 159 Score = 75.5 bits (184), Expect = 5e-14 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = +1 Query: 361 KGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 K IVFSQWT+MLD LEACL + SI + RLDGTMS+ RDKAVKDFN LP+ Sbjct: 6 KAIVFSQWTRMLDLLEACLKNSSIQYRRLDGTMSVLARDKAVKDFNTLPE 55 >gb|PKI77570.1| hypothetical protein CRG98_002024 [Punica granatum] Length = 155 Score = 74.7 bits (182), Expect = 9e-14 Identities = 36/50 (72%), Positives = 39/50 (78%) Frame = +1 Query: 361 KGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 K IVFSQWT+MLD LE CL SI F RLDGTMS+ RDKAVKDFN LP+ Sbjct: 2 KAIVFSQWTRMLDLLEVCLKSSSIQFRRLDGTMSVIARDKAVKDFNTLPE 51 >gb|KVH87633.1| Helicase, C-terminal [Cynara cardunculus var. scolymus] Length = 1346 Score = 78.6 bits (192), Expect = 1e-13 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LEACL D SI + RLDGTMS+ RDKAVKDFN LP+ Sbjct: 1192 EKAIVFSQWTRMLDLLEACLKDSSIGYRRLDGTMSVVARDKAVKDFNTLPE 1242 >gb|PLY99621.1| hypothetical protein LSAT_4X55800 [Lactuca sativa] Length = 1178 Score = 78.2 bits (191), Expect = 1e-13 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LEACL D SI + RLDGTMS+ RDKAVKDFN LP+ Sbjct: 1024 EKAIVFSQWTRMLDLLEACLKDSSIGYRRLDGTMSVLARDKAVKDFNTLPE 1074 >ref|XP_023739690.1| helicase-like transcription factor CHR28 [Lactuca sativa] Length = 1180 Score = 78.2 bits (191), Expect = 1e-13 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LEACL D SI + RLDGTMS+ RDKAVKDFN LP+ Sbjct: 1026 EKAIVFSQWTRMLDLLEACLKDSSIGYRRLDGTMSVLARDKAVKDFNTLPE 1076 >ref|XP_007159279.1| hypothetical protein PHAVU_002G224600g [Phaseolus vulgaris] gb|ESW31273.1| hypothetical protein PHAVU_002G224600g [Phaseolus vulgaris] Length = 1304 Score = 77.8 bits (190), Expect = 2e-13 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 DK IVFSQWT+MLD LEACL SI++ RLDGTMS+ RDKAVKDFN LP+ Sbjct: 1150 DKAIVFSQWTRMLDLLEACLKKSSINYRRLDGTMSVVARDKAVKDFNTLPE 1200 >ref|XP_007148208.1| hypothetical protein PHAVU_006G189200g [Phaseolus vulgaris] gb|ESW20202.1| hypothetical protein PHAVU_006G189200g [Phaseolus vulgaris] Length = 1189 Score = 77.4 bits (189), Expect = 2e-13 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LEACL + SI + RLDGTMS+ RDKAVKDFN LP+ Sbjct: 1035 EKAIVFSQWTRMLDLLEACLKNSSIQYRRLDGTMSVSARDKAVKDFNNLPE 1085 >ref|XP_007148209.1| hypothetical protein PHAVU_006G189200g [Phaseolus vulgaris] gb|ESW20203.1| hypothetical protein PHAVU_006G189200g [Phaseolus vulgaris] Length = 1288 Score = 77.4 bits (189), Expect = 2e-13 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LEACL + SI + RLDGTMS+ RDKAVKDFN LP+ Sbjct: 1134 EKAIVFSQWTRMLDLLEACLKNSSIQYRRLDGTMSVSARDKAVKDFNNLPE 1184 >gb|KVI00959.1| hypothetical protein Ccrd_020771 [Cynara cardunculus var. scolymus] Length = 1318 Score = 77.4 bits (189), Expect = 2e-13 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LE+CL D SI + RLDGTMS+ RDKAVKDFN LP+ Sbjct: 1164 EKAIVFSQWTRMLDLLESCLKDSSIGYRRLDGTMSVVARDKAVKDFNSLPE 1214 >ref|XP_022642626.1| helicase-like transcription factor CHR28 isoform X7 [Vigna radiata var. radiata] Length = 739 Score = 77.0 bits (188), Expect = 3e-13 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LEACL + SI + RLDGTMS+ RDKAVKDFN LP+ Sbjct: 585 EKAIVFSQWTRMLDLLEACLKNSSIQYRRLDGTMSVSARDKAVKDFNTLPE 635 >gb|KYP63025.1| putative ATP-dependent helicase C23E6.02 [Cajanus cajan] Length = 966 Score = 77.0 bits (188), Expect = 3e-13 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LEACL + SI + RLDGTMS+ RDKAVKDFN LP+ Sbjct: 812 EKAIVFSQWTRMLDLLEACLKNSSIQYRRLDGTMSVTARDKAVKDFNTLPE 862 >ref|XP_022642624.1| helicase-like transcription factor CHR28 isoform X5 [Vigna radiata var. radiata] Length = 1126 Score = 77.0 bits (188), Expect = 3e-13 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LEACL + SI + RLDGTMS+ RDKAVKDFN LP+ Sbjct: 972 EKAIVFSQWTRMLDLLEACLKNSSIQYRRLDGTMSVSARDKAVKDFNTLPE 1022 >ref|XP_020221969.1| helicase-like transcription factor CHR28 isoform X2 [Cajanus cajan] Length = 1135 Score = 77.0 bits (188), Expect = 3e-13 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LEACL + SI + RLDGTMS+ RDKAVKDFN LP+ Sbjct: 981 EKAIVFSQWTRMLDLLEACLKNSSIQYRRLDGTMSVTARDKAVKDFNTLPE 1031 >ref|XP_022018166.1| helicase-like transcription factor CHR28 isoform X2 [Helianthus annuus] Length = 1150 Score = 77.0 bits (188), Expect = 3e-13 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LEACL SI + RLDGTMSI RDKAVKDFN LP+ Sbjct: 996 EKAIVFSQWTRMLDLLEACLNKSSIGYRRLDGTMSIAARDKAVKDFNTLPE 1046 >ref|XP_022018165.1| helicase-like transcription factor CHR28 isoform X1 [Helianthus annuus] gb|OTF92069.1| putative SNF2-related, N-terminal domain-containing protein [Helianthus annuus] Length = 1153 Score = 77.0 bits (188), Expect = 3e-13 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LEACL SI + RLDGTMSI RDKAVKDFN LP+ Sbjct: 999 EKAIVFSQWTRMLDLLEACLNKSSIGYRRLDGTMSIAARDKAVKDFNTLPE 1049 >ref|XP_006594608.1| PREDICTED: uncharacterized ATP-dependent helicase C23E6.02-like isoform X2 [Glycine max] gb|KRH21515.1| hypothetical protein GLYMA_13G243600 [Glycine max] Length = 1216 Score = 77.0 bits (188), Expect = 3e-13 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LEACL + SI + RLDGTMS+ RDKAVKDFN LP+ Sbjct: 1062 EKAIVFSQWTRMLDLLEACLKNSSIQYRRLDGTMSVTARDKAVKDFNTLPE 1112 >ref|XP_017436292.1| PREDICTED: helicase-like transcription factor CHR28 isoform X2 [Vigna angularis] Length = 1221 Score = 77.0 bits (188), Expect = 3e-13 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LEACL + SI + RLDGTMS+ RDKAVKDFN LP+ Sbjct: 1067 EKAIVFSQWTRMLDLLEACLKNSSIQYRRLDGTMSVSARDKAVKDFNTLPE 1117 >ref|XP_014518410.1| helicase-like transcription factor CHR28 isoform X4 [Vigna radiata var. radiata] Length = 1221 Score = 77.0 bits (188), Expect = 3e-13 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LEACL + SI + RLDGTMS+ RDKAVKDFN LP+ Sbjct: 1067 EKAIVFSQWTRMLDLLEACLKNSSIQYRRLDGTMSVSARDKAVKDFNTLPE 1117 >gb|KRH10808.1| hypothetical protein GLYMA_15G070100 [Glycine max] Length = 1223 Score = 77.0 bits (188), Expect = 3e-13 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LEACL + SI + RLDGTMS+ RDKAVKDFN LP+ Sbjct: 1069 EKAIVFSQWTRMLDILEACLKNSSIQYRRLDGTMSVTARDKAVKDFNTLPE 1119 >gb|KOM53821.1| hypothetical protein LR48_Vigan09g248000 [Vigna angularis] Length = 1227 Score = 77.0 bits (188), Expect = 3e-13 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = +1 Query: 358 DKGIVFSQWTKMLDFLEACLTDFSISF*RLDGTMSIPERDKAVKDFNRLPK 510 +K IVFSQWT+MLD LEACL + SI + RLDGTMS+ RDKAVKDFN LP+ Sbjct: 1166 EKAIVFSQWTRMLDLLEACLKNSSIQYRRLDGTMSVSARDKAVKDFNTLPE 1216