BLASTX nr result
ID: Chrysanthemum21_contig00013844
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00013844 (427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023742362.1| replication protein A 70 kDa DNA-binding sub... 48 4e-08 gb|KVH91342.1| Nucleic acid-binding, OB-fold [Cynara cardunculus... 50 6e-07 ref|XP_023742355.1| replication protein A 70 kDa DNA-binding sub... 45 4e-06 >ref|XP_023742362.1| replication protein A 70 kDa DNA-binding subunit A-like [Lactuca sativa] Length = 703 Score = 47.8 bits (112), Expect(2) = 4e-08 Identities = 23/40 (57%), Positives = 29/40 (72%) Frame = +3 Query: 12 YRIMLSDGSVCINGFINKKINEMIRSKQLQKGSVVQLTHF 131 YR+ LSDGS G + + NE++ S+QLQKGSVVQLT F Sbjct: 50 YRVQLSDGSFHQQGMLATQRNELVTSQQLQKGSVVQLTEF 89 Score = 37.4 bits (85), Expect(2) = 4e-08 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Frame = +1 Query: 163 ISVRDLNVIRCNCIILGDPKPF-----SGNKTSVNEPIIPKSEEDHVDPDVNGDR 312 I + +LNVI C +GDPKPF G+ S+ P P + P VNG R Sbjct: 100 IIIINLNVIMEKCDTIGDPKPFPLKLPGGDTPSMTRPSPPTQSPSNQPPTVNGTR 154 >gb|KVH91342.1| Nucleic acid-binding, OB-fold [Cynara cardunculus var. scolymus] Length = 833 Score = 49.7 bits (117), Expect(2) = 6e-07 Identities = 23/44 (52%), Positives = 32/44 (72%) Frame = +3 Query: 12 YRIMLSDGSVCINGFINKKINEMIRSKQLQKGSVVQLTHFSSIT 143 YR++LSDG G + + NE++RS+QLQKGS+VQLT F+ T Sbjct: 51 YRVLLSDGLFHQQGMLATQCNELVRSQQLQKGSIVQLTEFACNT 94 Score = 31.2 bits (69), Expect(2) = 6e-07 Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 4/32 (12%) Frame = +1 Query: 163 ISVRDLNVIRCNCIILGDPKPF----SGNKTS 246 I + DLNVI C ++GDPKPF SG++ S Sbjct: 101 IIIIDLNVILDKCDLIGDPKPFPLKPSGSEAS 132 >ref|XP_023742355.1| replication protein A 70 kDa DNA-binding subunit E-like [Lactuca sativa] gb|PLY67272.1| hypothetical protein LSAT_5X58641 [Lactuca sativa] Length = 315 Score = 44.7 bits (104), Expect(2) = 4e-06 Identities = 21/44 (47%), Positives = 31/44 (70%) Frame = +3 Query: 12 YRIMLSDGSVCINGFINKKINEMIRSKQLQKGSVVQLTHFSSIT 143 YR++LSDG G ++ +E++ S+QLQKGS+V+LT F IT Sbjct: 52 YRVLLSDGYFHRQGVLSANRSELVTSQQLQKGSIVKLTKFLCIT 95 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +1 Query: 163 ISVRDLNVIRCNCIILGDPKPFSGNKTSVNE 255 I + DLNVI C I+GDPKPF S N+ Sbjct: 102 IKIIDLNVILGGCDIIGDPKPFPHELPSNNQ 132