BLASTX nr result
ID: Chrysanthemum21_contig00013644
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00013644 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022035697.1| calcineurin B-like protein 4 [Helianthus ann... 56 8e-07 ref|XP_023746481.1| calcineurin B-like protein 7 [Lactuca sativa] 55 2e-06 >ref|XP_022035697.1| calcineurin B-like protein 4 [Helianthus annuus] gb|OTG29285.1| putative calcineurin B-like protein 5 [Helianthus annuus] Length = 217 Score = 55.8 bits (133), Expect = 8e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +2 Query: 2 NMTLPHLTDITLRFPSFVMNSQVEETQST 88 NMTLPHL DITLRFPSFVMNSQVEET +T Sbjct: 188 NMTLPHLMDITLRFPSFVMNSQVEETYTT 216 >ref|XP_023746481.1| calcineurin B-like protein 7 [Lactuca sativa] Length = 217 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 NMTLPHLTDITLRFPSFVMNSQVEETQSTD 91 NMTLPHL DITLRFPSFVM SQVEE+ +TD Sbjct: 188 NMTLPHLMDITLRFPSFVMTSQVEESHTTD 217