BLASTX nr result
ID: Chrysanthemum21_contig00013452
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00013452 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022025397.1| E3 ubiquitin-protein ligase SIRP1-like [Heli... 62 2e-08 ref|XP_023748650.1| E3 ubiquitin-protein ligase SIRP1-like [Lact... 61 3e-08 gb|KVI00270.1| Zinc finger, RING/FYVE/PHD-type [Cynara carduncul... 60 6e-08 >ref|XP_022025397.1| E3 ubiquitin-protein ligase SIRP1-like [Helianthus annuus] ref|XP_022025398.1| E3 ubiquitin-protein ligase SIRP1-like [Helianthus annuus] gb|OTF86879.1| putative RING/U-box superfamily protein [Helianthus annuus] Length = 371 Score = 61.6 bits (148), Expect = 2e-08 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +2 Query: 326 MEEDRESIRYWCHQCTRPVVPILGVETVKCSS 421 MEEDRE RYWCHQC V+PILGVETVKCSS Sbjct: 1 MEEDRELTRYWCHQCNMQVIPILGVETVKCSS 32 >ref|XP_023748650.1| E3 ubiquitin-protein ligase SIRP1-like [Lactuca sativa] ref|XP_023748651.1| E3 ubiquitin-protein ligase SIRP1-like [Lactuca sativa] gb|PLY62467.1| hypothetical protein LSAT_1X71221 [Lactuca sativa] Length = 342 Score = 61.2 bits (147), Expect = 3e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 326 MEEDRESIRYWCHQCTRPVVPILGVETVKCSS 421 M+EDRES RYWCHQC RPVVPI+ V T+KCSS Sbjct: 1 MDEDRESTRYWCHQCNRPVVPIIEVLTIKCSS 32 >gb|KVI00270.1| Zinc finger, RING/FYVE/PHD-type [Cynara cardunculus var. scolymus] Length = 396 Score = 60.5 bits (145), Expect = 6e-08 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 326 MEEDRESIRYWCHQCTRPVVPILGVETVKCSS 421 MEEDRES RYWC++C RPV+PIL VE +KCSS Sbjct: 1 MEEDRESTRYWCYECNRPVIPILEVEAIKCSS 32