BLASTX nr result
ID: Chrysanthemum21_contig00013291
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00013291 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY84830.1| hypothetical protein LSAT_4X90541 [Lactuca sativa] 104 3e-26 >gb|PLY84830.1| hypothetical protein LSAT_4X90541 [Lactuca sativa] Length = 115 Score = 104 bits (259), Expect = 3e-26 Identities = 67/118 (56%), Positives = 76/118 (64%), Gaps = 11/118 (9%) Frame = -2 Query: 368 MSPAWSSHGVVTMLATTIAVSGTMIFLSLRRTTATNTSSIKNRDLNHEESP---SQPPRR 198 MSP WSS GVV AT +AVSGTMI LSL R+TAT S +N D N E+P + PPRR Sbjct: 1 MSPVWSSQGVV--FATAMAVSGTMILLSLLRSTAT--FSDENGDSNTAEAPPPPTPPPRR 56 Query: 197 RSCLSSXXXXXXXXXKVRFAENVKD--------IEYVSNCGSETMDFNGARSLLVELS 48 RSCLS+ KVRF ENV+D IEY SNC ETMD NGAR+LLVE+S Sbjct: 57 RSCLSTVKKDGRMKKKVRFLENVEDTDRKAWREIEYASNCKIETMDLNGARTLLVEVS 114