BLASTX nr result
ID: Chrysanthemum21_contig00013105
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00013105 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014788955.1| PREDICTED: ubiquitin-conjugating enzyme E2 G... 53 3e-06 ref|XP_017247958.1| PREDICTED: ubiquitin-conjugating enzyme E2 7... 53 9e-06 >ref|XP_014788955.1| PREDICTED: ubiquitin-conjugating enzyme E2 G1-like [Octopus bimaculoides] gb|KOF65287.1| hypothetical protein OCBIM_22015998mg [Octopus bimaculoides] Length = 98 Score = 52.8 bits (125), Expect = 3e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +1 Query: 1 ANVDAAKMWREEKDEFRKTVSRCVKKSHEAF 93 ANV+AAKMWRE+ DEF++TVS+CV+KS E F Sbjct: 66 ANVEAAKMWREQPDEFKRTVSKCVRKSQEDF 96 >ref|XP_017247958.1| PREDICTED: ubiquitin-conjugating enzyme E2 7-like [Daucus carota subsp. sativus] Length = 168 Score = 53.1 bits (126), Expect = 9e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +1 Query: 1 ANVDAAKMWREEKDEFRKTVSRCVKKSHEAF 93 AN+DAAK WR++KDEF+K VSRCV+KS E F Sbjct: 138 ANIDAAKQWRDKKDEFKKKVSRCVRKSQEMF 168