BLASTX nr result
ID: Chrysanthemum21_contig00012996
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum21_contig00012996 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023736309.1| acyltransferase-like protein At3g26840, chlo... 85 2e-16 ref|XP_023736308.1| acyltransferase-like protein At3g26840, chlo... 85 2e-16 gb|PLY71888.1| hypothetical protein LSAT_4X185980 [Lactuca sativa] 85 2e-16 ref|XP_023736307.1| acyltransferase-like protein At3g26840, chlo... 85 2e-16 ref|XP_023736306.1| acyltransferase-like protein At3g26840, chlo... 85 2e-16 ref|XP_022012574.1| acyltransferase-like protein At3g26840, chlo... 73 2e-12 ref|XP_022012573.1| acyltransferase-like protein At3g26840, chlo... 73 2e-12 ref|XP_022012572.1| acyltransferase-like protein At3g26840, chlo... 73 2e-12 ref|XP_022750443.1| acyltransferase-like protein At3g26840, chlo... 65 2e-09 ref|XP_022750441.1| acyltransferase-like protein At3g26840, chlo... 65 2e-09 ref|XP_010249147.1| PREDICTED: acyltransferase-like protein At1g... 64 4e-09 ref|XP_022750442.1| acyltransferase-like protein At3g26840, chlo... 63 1e-08 ref|XP_022750440.1| acyltransferase-like protein At3g26840, chlo... 63 1e-08 ref|XP_024021158.1| acyltransferase-like protein At3g26840, chlo... 61 4e-08 gb|EXB62869.1| Acyltransferase-like protein [Morus notabilis] 61 4e-08 gb|OVA09634.1| Diacylglycerol acyltransferase [Macleaya cordata] 61 5e-08 ref|XP_020980754.1| acyltransferase-like protein At3g26840, chlo... 60 1e-07 ref|XP_020980753.1| acyltransferase-like protein At3g26840, chlo... 60 1e-07 ref|XP_020980752.1| acyltransferase-like protein At3g26840, chlo... 60 1e-07 gb|KCW55787.1| hypothetical protein EUGRSUZ_I01614 [Eucalyptus g... 59 3e-07 >ref|XP_023736309.1| acyltransferase-like protein At3g26840, chloroplastic isoform X4 [Lactuca sativa] Length = 550 Score = 84.7 bits (208), Expect = 2e-16 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 268 DKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHRF 402 +++HDLVT LK TSFYRRTRNVDYVLDYLPPTP+EF KARE+HRF Sbjct: 207 EQDHDLVTTLKGTSFYRRTRNVDYVLDYLPPTPYEFQKARESHRF 251 >ref|XP_023736308.1| acyltransferase-like protein At3g26840, chloroplastic isoform X3 [Lactuca sativa] Length = 638 Score = 84.7 bits (208), Expect = 2e-16 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 268 DKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHRF 402 +++HDLVT LK TSFYRRTRNVDYVLDYLPPTP+EF KARE+HRF Sbjct: 295 EQDHDLVTTLKGTSFYRRTRNVDYVLDYLPPTPYEFQKARESHRF 339 >gb|PLY71888.1| hypothetical protein LSAT_4X185980 [Lactuca sativa] Length = 638 Score = 84.7 bits (208), Expect = 2e-16 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 268 DKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHRF 402 +++HDLVT LK TSFYRRTRNVDYVLDYLPPTP+EF KARE+HRF Sbjct: 303 EQDHDLVTTLKGTSFYRRTRNVDYVLDYLPPTPYEFQKARESHRF 347 >ref|XP_023736307.1| acyltransferase-like protein At3g26840, chloroplastic isoform X2 [Lactuca sativa] Length = 666 Score = 84.7 bits (208), Expect = 2e-16 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 268 DKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHRF 402 +++HDLVT LK TSFYRRTRNVDYVLDYLPPTP+EF KARE+HRF Sbjct: 331 EQDHDLVTTLKGTSFYRRTRNVDYVLDYLPPTPYEFQKARESHRF 375 >ref|XP_023736306.1| acyltransferase-like protein At3g26840, chloroplastic isoform X1 [Lactuca sativa] Length = 674 Score = 84.7 bits (208), Expect = 2e-16 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 268 DKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHRF 402 +++HDLVT LK TSFYRRTRNVDYVLDYLPPTP+EF KARE+HRF Sbjct: 331 EQDHDLVTTLKGTSFYRRTRNVDYVLDYLPPTPYEFQKARESHRF 375 >ref|XP_022012574.1| acyltransferase-like protein At3g26840, chloroplastic isoform X3 [Helianthus annuus] Length = 562 Score = 73.2 bits (178), Expect = 2e-12 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +1 Query: 268 DKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHRF 402 D++ DLVT+LK SFYRRTR +DYV DYLPPT +EF KARE+HRF Sbjct: 230 DQDFDLVTVLKGASFYRRTRKLDYVSDYLPPTDYEFRKARESHRF 274 >ref|XP_022012573.1| acyltransferase-like protein At3g26840, chloroplastic isoform X2 [Helianthus annuus] Length = 659 Score = 73.2 bits (178), Expect = 2e-12 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +1 Query: 268 DKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHRF 402 D++ DLVT+LK SFYRRTR +DYV DYLPPT +EF KARE+HRF Sbjct: 327 DQDFDLVTVLKGASFYRRTRKLDYVSDYLPPTDYEFRKARESHRF 371 >ref|XP_022012572.1| acyltransferase-like protein At3g26840, chloroplastic isoform X1 [Helianthus annuus] gb|OTF95773.1| putative transferase, transferring acyl groups other than amino-acyl group [Helianthus annuus] Length = 661 Score = 73.2 bits (178), Expect = 2e-12 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +1 Query: 268 DKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHRF 402 D++ DLVT+LK SFYRRTR +DYV DYLPPT +EF KARE+HRF Sbjct: 329 DQDFDLVTVLKGASFYRRTRKLDYVSDYLPPTDYEFRKARESHRF 373 >ref|XP_022750443.1| acyltransferase-like protein At3g26840, chloroplastic isoform X4 [Durio zibethinus] Length = 706 Score = 65.1 bits (157), Expect = 2e-09 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = +1 Query: 268 DKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHRF 402 + N DLVTI+KATSFYRR + +DYV DY+PPTP+EF K +E++R+ Sbjct: 374 EDNVDLVTIIKATSFYRRGKYLDYVSDYMPPTPYEFKKIQESNRW 418 >ref|XP_022750441.1| acyltransferase-like protein At3g26840, chloroplastic isoform X2 [Durio zibethinus] Length = 755 Score = 64.7 bits (156), Expect = 2e-09 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = +1 Query: 268 DKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHR 399 + N DLVTI+KATSFYRR + +DYV DY+PPTP+EF K +E++R Sbjct: 374 EDNVDLVTIIKATSFYRRGKYLDYVSDYMPPTPYEFKKIQESNR 417 >ref|XP_010249147.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic [Nelumbo nucifera] Length = 688 Score = 63.9 bits (154), Expect = 4e-09 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +1 Query: 280 DLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHRF 402 DLVTI+K SFYRR R++DYV DY+PPTPFEF +A E++R+ Sbjct: 360 DLVTIIKGASFYRRKRHIDYVSDYVPPTPFEFKQAYESYRW 400 >ref|XP_022750442.1| acyltransferase-like protein At3g26840, chloroplastic isoform X3 [Durio zibethinus] Length = 710 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = +1 Query: 268 DKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAH 396 + N DLVTI+KATSFYRR + +DYV DY+PPTP+EF K +E++ Sbjct: 321 EDNVDLVTIIKATSFYRRGKYLDYVSDYMPPTPYEFKKIQESN 363 >ref|XP_022750440.1| acyltransferase-like protein At3g26840, chloroplastic isoform X1 [Durio zibethinus] Length = 763 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = +1 Query: 268 DKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAH 396 + N DLVTI+KATSFYRR + +DYV DY+PPTP+EF K +E++ Sbjct: 374 EDNVDLVTIIKATSFYRRGKYLDYVSDYMPPTPYEFKKIQESN 416 >ref|XP_024021158.1| acyltransferase-like protein At3g26840, chloroplastic [Morus notabilis] Length = 706 Score = 61.2 bits (147), Expect = 4e-08 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = +1 Query: 280 DLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHRF 402 DLVTI+K+TSFYRR+R+ DYV DY+PPTP EF K E++++ Sbjct: 378 DLVTIIKSTSFYRRSRHPDYVFDYIPPTPSEFKKIMESNQW 418 >gb|EXB62869.1| Acyltransferase-like protein [Morus notabilis] Length = 748 Score = 61.2 bits (147), Expect = 4e-08 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = +1 Query: 280 DLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHRF 402 DLVTI+K+TSFYRR+R+ DYV DY+PPTP EF K E++++ Sbjct: 420 DLVTIIKSTSFYRRSRHPDYVFDYIPPTPSEFKKIMESNQW 460 >gb|OVA09634.1| Diacylglycerol acyltransferase [Macleaya cordata] Length = 732 Score = 60.8 bits (146), Expect = 5e-08 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = +1 Query: 268 DKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHRF 402 + + DLVT++K FYRRTRNVDYV D++PPTP EF + E++R+ Sbjct: 399 EDDFDLVTVIKGAGFYRRTRNVDYVSDFIPPTPSEFKQVCESYRW 443 >ref|XP_020980754.1| acyltransferase-like protein At3g26840, chloroplastic isoform X4 [Arachis duranensis] Length = 592 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +1 Query: 265 QDKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHR 399 Q+ N DLVT++K TSFYRR + DYV DY+PPTP EF + E++R Sbjct: 382 QEGNIDLVTVIKGTSFYRRGKKHDYVSDYIPPTPTEFKEVLESYR 426 >ref|XP_020980753.1| acyltransferase-like protein At3g26840, chloroplastic isoform X3 [Arachis duranensis] Length = 659 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +1 Query: 265 QDKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHR 399 Q+ N DLVT++K TSFYRR + DYV DY+PPTP EF + E++R Sbjct: 382 QEGNIDLVTVIKGTSFYRRGKKHDYVSDYIPPTPTEFKEVLESYR 426 >ref|XP_020980752.1| acyltransferase-like protein At3g26840, chloroplastic isoform X1 [Arachis duranensis] Length = 715 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/45 (57%), Positives = 34/45 (75%) Frame = +1 Query: 265 QDKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHR 399 Q+ N DLVT++K TSFYRR + DYV DY+PPTP EF + E++R Sbjct: 382 QEGNIDLVTVIKGTSFYRRGKKHDYVSDYIPPTPTEFKEVLESYR 426 >gb|KCW55787.1| hypothetical protein EUGRSUZ_I01614 [Eucalyptus grandis] Length = 541 Score = 58.5 bits (140), Expect = 3e-07 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = +1 Query: 268 DKNHDLVTILKATSFYRRTRNVDYVLDYLPPTPFEFSKAREAHRF 402 ++ DLVTI+K FYRR +++DYVLDYLPPTP E+ K E++R+ Sbjct: 209 EEGFDLVTIIKGARFYRRGKSLDYVLDYLPPTPAEYKKQFESNRW 253